Mus musculus (house mouse): 66212 Help Entry 66212             CDS       T01002                                  Symbol Sec61b, 1190006C12Rik Name (RefSeq) SEC61 translocon subunit beta   KO K09481   protein transport protein SEC61 subunit beta Organism mmu  Mus musculus (house mouse) Pathway mmu03060   Protein export mmu04141   Protein processing in endoplasmic reticulum mmu04145   Phagosome Brite KEGG Orthology (KO) [BR:mmu00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03060 Protein export     66212 (Sec61b)    04141 Protein processing in endoplasmic reticulum     66212 (Sec61b)  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     66212 (Sec61b)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:mmu04131]     66212 (Sec61b)   09183 Protein families: signaling and cellular processes    02044 Secretion system [BR:mmu02044]     66212 (Sec61b) Membrane trafficking [BR:mmu04131]  Endoplasmic reticulum (ER) - Golgi transport   Others    SEC61 complex     66212 (Sec61b) Secretion system [BR:mmu02044]  Sec (secretion) system   Eukaryotic Sec-SRP protein    66212 (Sec61b) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Sec61_beta Motif Other DBs NCBI-GeneID:  66212 NCBI-ProteinID:  NP_077133 MGI:  1913462 Ensembl:  ENSMUSG00000053317 UniProt:  Q9CQS8 LinkDB All DBs Position 4:47474661..47483233 Genome browser AA seq 96 aa AA seqDB search MPGPTPSGTNVGSSGRSPSKAVAARAAGSTVRQRKNASCGTRSAGRTTSAGTGGMWRFYT EDSPGLKVGPVPVLVMSLLFIAAVFMLHIWGKYTRS NT seq 291 nt NT seq  +upstreamnt  +downstreamnt atgccgggtccaacgcccagtggcaccaacgtgggctcctctggccgctctcccagcaaa gcggtggccgcacgggctgcgggatccactgttcggcagagaaaaaatgccagctgtggg acccggagcgcaggccgcaccacctctgcagggactggggggatgtggcgattctacacg gaagattccccagggctcaaagtgggccctgtcccagtgctggtgatgagtcttctgttc atcgctgctgtatttatgctgcacatttggggcaagtacacgcgatcatag

DBGET integrated database retrieval system