| Entry |
|
|---|
| Symbol |
Uqcr11, 0710008D09Rik, Uqcr
|
|---|
| Name |
(RefSeq) ubiquinol-cytochrome c reductase, complex III subunit XI
|
|---|
| KO |
| K00420 | ubiquinol-cytochrome c reductase subunit 10 |
|
|---|
| Organism |
mmu Mus musculus (house mouse)
|
|---|
| Pathway |
| mmu04932 | Non-alcoholic fatty liver disease |
| mmu05022 | Pathways of neurodegeneration - multiple diseases |
| mmu05208 | Chemical carcinogenesis - reactive oxygen species |
|
|---|
| Module |
|
|---|
| Brite |
KEGG Orthology (KO) [BR:mmu00001]
09100 Metabolism
09102 Energy metabolism
00190 Oxidative phosphorylation
66594 (Uqcr11)
09150 Organismal Systems
09153 Circulatory system
04260 Cardiac muscle contraction
66594 (Uqcr11)
09159 Environmental adaptation
04714 Thermogenesis
66594 (Uqcr11)
09160 Human Diseases
09161 Cancer: overview
05208 Chemical carcinogenesis - reactive oxygen species
66594 (Uqcr11)
09164 Neurodegenerative disease
05010 Alzheimer disease
66594 (Uqcr11)
05012 Parkinson disease
66594 (Uqcr11)
05014 Amyotrophic lateral sclerosis
66594 (Uqcr11)
05016 Huntington disease
66594 (Uqcr11)
05020 Prion disease
66594 (Uqcr11)
05022 Pathways of neurodegeneration - multiple diseases
66594 (Uqcr11)
09166 Cardiovascular disease
05415 Diabetic cardiomyopathy
66594 (Uqcr11)
09167 Endocrine and metabolic disease
04932 Non-alcoholic fatty liver disease
66594 (Uqcr11)
|
|---|
| SSDB |
|
|---|
| Motif |
|
|---|
| Other DBs |
|
|---|
| Structure |
|
|---|
| LinkDB |
|
|---|
| Position |
10:complement(80238831..80242655)
|
|---|
| AA seq |
56 aa
MLSRFLGPRYRELARNWIPTAGMWGTVGAVGLVWATDWRLILDWVPYINGKFKKDD |
|---|
| NT seq |
171 nt +upstreamnt +downstreamnt
atgctgagcaggtttctaggcccgcgctaccgggaactggccagaaactggattcccaca
gccggcatgtggggcactgtgggtgccgtgggactggtgtgggccacggactggcggctg
atcctggactgggtgccttacatcaacggcaagtttaagaaggacgattag |
|---|
