KEGG   Mus musculus (house mouse): 66911
Entry
66911             CDS       T01002                                 
Symbol
Nudt16l1, 1110001K21Rik, 5330437I08Rik, Sdos
Name
(RefSeq) nudix (nucleoside diphosphate linked moiety X)-type motif 16-like 1
  KO
K16867  NUDT16-like protein 1
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    66911 (Nudt16l1)
SSDB
Other DBs
NCBI-GeneID: 66911
NCBI-ProteinID: NP_080115
MGI: 1914161
Ensembl: ENSMUSG00000022516
UniProt: Q8VHN8
Structure
LinkDB
Position
16:4756975..4758892
AA seq 211 aa
MSTTTVPELKQISREEAMRLGPGWSHSCHAMLYAANPGQLFGRIPMRFSVLMQMRFDGLL
GFPGGFVDRRFWSLEDGLNRVLGLGLGGLRLTEADYLSSHLTEGPHRVVAHLYARQLTLE
QLHAVEISAVHSRDHGLEVLGLVRVPLYTQKDRVGGFPNFLSNAFVSTAKYQLLFALKVL
NMMPSEKLAEALASATEKQKKALEKLLPPSS
NT seq 636 nt   +upstreamnt  +downstreamnt
atgtcgaccacgacggttccggagctgaaacagatcagtcgggaggaagcaatgcgcttg
gggcccggctggagtcattcatgccacgccatgctatacgccgccaaccccgggcagctt
ttcggacgtatccccatgcgtttctcagtgctgatgcagatgcgcttcgacgggctgcta
ggctttcccgggggtttcgtggaccggcgcttctggtcgctggaggatggcttgaatcgg
gtgctgggcctgggcctgggcggcctacgccttaccgaagctgattacctgagttcacac
ctgactgagggtccacaccgtgtggtggcacatctgtacgcacggcagctgacattggaa
caactgcatgctgtggagatcagcgctgtgcactcacgggaccacggtctggaggtcctg
ggccttgtacgggtcccactgtacacacagaaggatcgagtaggcggctttcctaacttt
ctgagcaacgccttcgtcagcactgccaaatatcaacttctatttgcccttaaggtactc
aacatgatgccctcggaaaagctggccgaggccttggcctcagcaacagagaagcagaag
aaggctctagaaaagctgctcccgccctcatcctga

DBGET integrated database retrieval system