Mus musculus (house mouse): 67117 Help Entry 67117             CDS       T01002                                  Symbol Dynlt3, 2310075M16Rik, Tcte1l Name (RefSeq) dynein light chain Tctex-type 3   KO K10420   dynein light chain Tctex-type 1/3 Organism mmu  Mus musculus (house mouse) Pathway mmu04814   Motor proteins mmu05132   Salmonella infection Brite KEGG Orthology (KO) [BR:mmu00001]  09140 Cellular Processes   09142 Cell motility    04814 Motor proteins     67117 (Dynlt3)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     67117 (Dynlt3)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:mmu03037]     67117 (Dynlt3)    04812 Cytoskeleton proteins [BR:mmu04812]     67117 (Dynlt3) Cilium and associated proteins [BR:mmu03037]  Motile cilia and associated proteins   Dynein arm    67117 (Dynlt3) Cytoskeleton proteins [BR:mmu04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      67117 (Dynlt3) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Tctex-1 Motif Other DBs NCBI-GeneID:  67117 NCBI-ProteinID:  NP_080251 MGI:  1914367 Ensembl:  ENSMUSG00000031176 UniProt:  P56387 Q542J7 LinkDB All DBs Position X:complement(9520509..9529222) Genome browser AA seq 116 aa AA seqDB search MEGYQRPCDEVGFNADEAHNIVKECVDGVLGGNDYNENNINQWTASIVEQSITHLVKLGK AYKYIVTCAVVQRSPYGFHTASSCFWDTTSDGTCTIRWENRTMNCIVNVFAVAIVL NT seq 351 nt NT seq  +upstreamnt  +downstreamnt atggaggggtaccaacggccctgcgatgaggttggcttcaatgctgatgaagcccataat atagtcaaagagtgtgttgatggagttttgggtggtaacgattataatgagaataacatc aaccaatggactgcaagcatagtggaacagtctataacacatttggtcaaactggggaaa gcttacaagtacattgtgacctgtgcagtggtccagaggagcccgtatggatttcacaca gccagctcctgtttttgggatacaacatctgatggaacctgtaccatcagatgggagaac cgtaccatgaactgcatcgtgaatgtttttgcagttgcgattgtcctgtag

DBGET integrated database retrieval system