Mus musculus (house mouse): 67673 Help Entry 67673             CDS       T01002                                  Symbol Elob, 0610040H15Rik, Tceb2 Name (RefSeq) elongin B   KO K03873   elongin-B Organism mmu  Mus musculus (house mouse) Pathway mmu04066   HIF-1 signaling pathway mmu04120   Ubiquitin mediated proteolysis mmu05170   Human immunodeficiency virus 1 infection mmu05200   Pathways in cancer mmu05211   Renal cell carcinoma Brite KEGG Orthology (KO) [BR:mmu00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     67673 (Elob)  09130 Environmental Information Processing   09132 Signal transduction    04066 HIF-1 signaling pathway     67673 (Elob)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     67673 (Elob)   09162 Cancer: specific types    05211 Renal cell carcinoma     67673 (Elob)   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     67673 (Elob)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:mmu04121]     67673 (Elob)    03400 DNA repair and recombination proteins [BR:mmu03400]     67673 (Elob) Ubiquitin system [BR:mmu04121]  Ubiquitin ligases (E3)   Multi subunit Ring-finger type E3    Cul2 complex     Adoptor protein      67673 (Elob)    Cul5 complex      67673 (Elob) DNA repair and recombination proteins [BR:mmu03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     Other NER factors      67673 (Elob) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ubiquitin Rad60-SLD Motif Other DBs NCBI-GeneID:  67673 NCBI-ProteinID:  NP_080581 MGI:  1914923 Ensembl:  ENSMUSG00000055839 UniProt:  P62869 Structure PDB LinkDB All DBs Position 17:complement(24043714..24048083) Genome browser AA seq 118 aa AA seqDB search MDVFLMIRRHKTTIFTDAKESSTVFELKRIVEGILKRPPEEQRLYKDDQLLDDGKTLGEC GFTSQTARPQAPATVGLAFRADDTFEALRIEPFSSPPELPDVMKPQDSGGSANEQAVQ NT seq 357 nt NT seq  +upstreamnt  +downstreamnt atggacgtgtttctcatgatccggcgccacaagaccaccatctttacggacgccaaggag tcgagcaccgtgttcgaactgaagcgcatcgtcgagggcatcctcaagcggccgccagag gagcagcggctttacaaggatgaccagctccttgatgatggcaaaactctgggcgagtgt ggcttcactagccagacagcacggccacaggccccagccacagtgggcctggccttccga gcagatgacaccttcgaagctctccgcatcgagcccttttccagccctccagagcttcca gatgtgatgaagccacaggattctggaggcagtgccaatgaacaagctgtgcagtga

DBGET integrated database retrieval system