KEGG   Mus musculus (house mouse): 69601
Entry
69601             CDS       T01002                                 
Symbol
Dab2ip, 2310011D08Rik, AI480459, Aip1, mKIAA1743
Name
(RefSeq) disabled 2 interacting protein
  KO
K19901  disabled homolog 2-interacting protein
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04210  Apoptosis
mmu04668  TNF signaling pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    69601 (Dab2ip)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    69601 (Dab2ip)
SSDB
Motif
Pfam: DUF3498 RasGAP C2 Bacillus_HBL PH PH_2 Med4
Other DBs
NCBI-GeneID: 69601
NCBI-ProteinID: NP_001107596
MGI: 1916851
Ensembl: ENSMUSG00000026883
UniProt: Q3UHC7 Q52KF5
LinkDB
Position
2:35448285..35621006
AA seq 1189 aa
MSAGGNARKSTGRPSYYYRLLRRPRLQRQRSRSRSRTRPARESPQERPGSRRSLPGSMSE
KNPSMEPSASTPFRVTGFLSRRLKGSIKRTKSQPKLDRNHSFRHILPGFRSAAAAAADNE
RSHLMPRLKESRSHESLLSPSSAVEALDLSMEEEVIIKPVHSSILGQDYCFEVTTSSGSK
CFSCRSAAERDKWMENLRRAVHPNKDNSRRVEHILKLWVIEAKDLPAKKKYLCELCLDDV
LYARTTSKLKTDNVFWGEHFEFHNLPPLRTVTVHLYRETDKKKKKERNSYLGLVSLPAAS
VAGRQFVEKWYPVVTPNPKGGKGPGPMIRIKARYQTVSILPMEMYKEFAEHITNHYLGLC
AALEPILSAKTKEEMASALVHILQSTGKVKDFLTDLMMSEVDRCGDNEHLIFRENTLATK
AIEEYLKLVGQKYLQDALGEFIKALYESDENCEVDPSKCSSADLPEHQGNLKMCCELAFC
KIINSYCVFPRELKEVFASWRQECSSRGRPDISERLISASLFLRFLCPAIMSPSLFNLLQ
EYPDDRTARTLTLIAKVTQNLANFAKFGSKEEYMSFMNQFLEHEWTNMQRFLLEISNPET
LSNTAGFEGYIDLGRELSSLHSLLWEAVSQLDQSVVSKLGPLPRILRDVHTALSTPGSGQ
LPGTNDLASTPGSGSSSVSAGLQKMVIENDLSGLIDFTRLPSPTPENKDLFFVTRSSGVQ
PSPARSSSYSEANEPDLQMANGSKSLSMVDLQDARTLDGEAGSPVGPDALPADGQVPATQ
LLAGWPARAAPVSLAGLATVRRAVPTPTTPGTSEGAPGRPQLLAPLSFQNPVYQMAAGLP
LSPRGLGDSGSEGHSSLSSHSNSEELAAAAKLGSFSTAAEELARRPGELARRQMSLTEKG
GQPTVPRQNSAGPQRRIDQPPPPPPPPPPAPRGRTPPTLLSTLQYPRPSSGTLASASPDW
AGPGTRLRQQSSSSKGDSPELKPRAMHKQGPSPVSPNALDRTAAWLLTMNAQLLEDEGLG
PDPPHRDRLRSKEELSQAEKDLAVLQDKLRISTKKLEEYETLFKCQEETTQKLVLEYQAR
LEEGEERLRRQQEDKDIQMKGIISRLMSVEEELKKDHAEMQAAVDSKQKIIDAQEKRIAS
LDAANARLMSALTQLKERYSMQARNGVSPTNPTKLQITENGEFRNSSNC
NT seq 3570 nt   +upstreamnt  +downstreamnt
atgtccgccggcggcaacgccaggaagagcaccgggaggccatcctactactaccggctg
ctgcggcggccccggctgcagcgacagaggagccgctcccgcagccggacccggccagcc
agggagtcgccccaagaaaggccgggctcccggcggagccttcccggcagcatgtcagag
aaaaaccccagcatggagccctcggcttcaaccccgttccgggtcacgggcttcctcagc
cgccgcctcaagggctccatcaagcgcaccaagagccagcccaaactggaccgcaaccac
agcttccgccacatcctgccggggttccggagcgcagccgccgccgccgcggacaatgag
aggtcccatctgatgccaaggctgaaggagtctcggtcacacgagtccctgctcagcccc
agcagcgcagtggaggccctggacctcagcatggaggaggaggtgattatcaagcccgtt
cacagcagcatcctgggtcaggactactgcttcgaggtgacaacatcatcaggaagcaag
tgtttttcctgccggtcagccgctgagcgcgataagtggatggagaacctgaggcgagca
gtgcaccccaacaaggacaacagccggcgtgtggagcatatcctgaagctgtgggtgatt
gaggccaaggatctgccggccaagaagaagtatctatgtgaactgtgcctggacgatgtg
ctgtatgcccgtaccacaagcaagctcaagacggacaatgtcttctggggagagcacttt
gagttccataacctgccgcctctacgcacagtcactgtgcacctgtatcgggagactgac
aagaaaaagaaaaaggaacgcaacagctacctgggcctggtgagcctgcctgccgcctct
gtggctgggcggcagtttgtggagaagtggtacccagtggtgacacccaaccccaagggt
ggcaaaggccctgggcccatgatccgaatcaaggcacgctaccagaccgtcagcatcttg
cctatggagatgtacaaggagtttgcggagcacatcactaaccactacctggggctgtgc
gcagccctggaacccatcctcagtgccaagaccaaggaggagatggcgtcggctctggtg
cacatcctgcagagcacgggaaaggtgaaggactttctaacagacctgatgatgtcagag
gtggaccgctgtggggacaatgagcacctcatcttccgggagaacacactggccaccaag
gccatcgaggaatacctcaaacttgtgggccagaagtacctgcaggacgcactaggtgag
ttcatcaaagctctgtatgagtcagatgaaaattgtgaagtggacccaagcaagtgctca
tccgctgacctccctgagcaccagggcaacctcaagatgtgctgtgagctggccttctgc
aagatcatcaactcctactgcgtcttcccacgggagcttaaggaggtgttcgcctcatgg
cggcaggagtgtagcagccgaggccggccagatatcagtgaacggctcatcagcgcctcc
ctcttccttcgcttcctgtgccctgccatcatgtcaccctcgctcttcaacctgcttcag
gagtatcctgacgaccgcacggctcgcaccctcacgctcattgccaaagtcacccagaac
ctggccaactttgccaagtttggcagcaaggaagaatacatgtccttcatgaaccagttc
ctggagcacgagtggaccaacatgcagcgcttcctgttggagatctccaaccccgagacc
ctttccaacacagcaggcttcgagggctacatagacctgggccgggagctctctagcctg
cactccctgctctgggaagctgtcagccagcttgatcagagcgttgtgtcgaagctggga
cctctgcctcgtatcctgagggatgtccacacagcactgagcactcctggcagtgggcag
ctccctggcaccaatgacctggcctccaccccgggctccggcagcagcagcgtctctgct
gggcttcagaagatggtgattgaaaatgacctctctggtctgatagatttcacccggtta
ccgtctccaacccccgaaaacaaggacttgttttttgtcacaaggtcctccggggtccag
ccttcacctgcccgcagctcaagctactcagaagccaatgaacctgacctgcagatggcc
aatggcagcaagagcctgtccatggtggacctccaggacgcccgcacgctggatggggag
gcaggttccccagtgggcccagacgccctacctgctgacgggcaggtgcctgcgactcag
ctgctggctgggtggccagccagggcagccccagtgagcctggcaggattggccacagtg
cggcgggcagtgccaacaccaaccacaccaggcacctccgagggtgcaccaggacggccc
cagttgttggccccactttccttccagaatcctgtgtaccagatggcggccggcctgcca
ctgtcaccccgtggccttggtgactcaggctctgaaggccacagctccctgagctctcac
agcaacagtgaagagctggcagccgctgccaaactaggaagtttcagcactgctgcagag
gagctggcaaggcggcctggagaactggcacggaggcagatgtcactgactgagaagggt
gggcagcccacagtgccgaggcaaaatagtgccggtccccagcggaggattgaccagccg
ccaccgccaccaccaccaccgcctcctgctccccggggcaggacacctcctaccctgctg
agcaccctacagtacccacgaccctcaagtggaaccctggcatcagcatcccccgactgg
gctggccctggcacccggctgcggcaacagtcctcctcctccaagggagacagcccagag
ctgaagccccgagccatgcacaagcagggcccttcacccgtcagtcccaatgccctggac
cgcacggccgcttggctcttgaccatgaacgcgcagttgttagaagacgagggtctgggc
ccagatcccccccacagggataggctaaggagtaaggaggaactcagccaagcagaaaag
gatctggcagtgctacaagacaagctacggatctccaccaagaagctggaggagtatgag
accctattcaagtgccaggaggagacgacgcagaagctggtgctggagtatcaggctcgg
ctggaagaaggtgaggagcggctgcggcggcagcaggaagacaaggatatccagatgaaa
ggcatcatcagcaggttgatgtcagtggaagaagaactgaagaaggatcatgcagagatg
caagcagctgtagattccaaacagaagatcatcgatgcccaggaaaagcgcattgcctcg
ctggatgctgccaatgcccgcctcatgagtgccctcacacagctgaaagagaggtacagc
atgcaagcccgtaacggcgtctcccccaccaaccccaccaaattgcagattactgagaac
ggcgagttcagaaacagcagcaattgttaa

DBGET integrated database retrieval system