KEGG   Mus musculus (house mouse): 74006
Entry
74006             CDS       T01002                                 
Symbol
Dnm1l, 6330417M19Rik, AI450666, Dlp1, Dnmlp1, Drp1, python
Name
(RefSeq) dynamin 1-like
  KO
K17065  dynamin 1-like protein [EC:3.6.5.5]
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04217  Necroptosis
mmu04621  NOD-like receptor signaling pathway
mmu04668  TNF signaling pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    74006 (Dnm1l)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    74006 (Dnm1l)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    74006 (Dnm1l)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    74006 (Dnm1l)
   03029 Mitochondrial biogenesis [BR:mmu03029]
    74006 (Dnm1l)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    74006 (Dnm1l)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.5  Acting on GTP to facilitate cellular and subcellular movement
    3.6.5.5  dynamin GTPase
     74006 (Dnm1l)
Membrane trafficking [BR:mmu04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Dynamin
    74006 (Dnm1l)
  Lipid raft mediated endocytosis
   Caveolin-mediated endocytosis
    74006 (Dnm1l)
   RhoA-dependent endocytosis
    74006 (Dnm1l)
Mitochondrial biogenesis [BR:mmu03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Fission and Fusion factors
    74006 (Dnm1l)
   Retention of mitochondria
    74006 (Dnm1l)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   74006 (Dnm1l)
SSDB
Motif
Pfam: Dynamin_M Dynamin_N GED MMR_HSR1 AAA_16 FtsK_SpoIIIE AAA_28 AAA_15
Other DBs
NCBI-GeneID: 74006
NCBI-ProteinID: NP_001263269
MGI: 1921256
Ensembl: ENSMUSG00000022789
UniProt: Q8K1M6
LinkDB
Position
16:complement(16130092..16176902)
AA seq 716 aa
MEALIPVINKLQDVFNTVGADIIQLPQIVVVGTQSSGKSSVLESLVGRDLLPRGTGVVTR
RPLILQLVHVSPEDKRKTTGEENGKFQSWRVEAEEWGKFLHTKNKLYTDFDEIRQEIENE
TERISGNNKGVSPEPIHLKVFSPNVVNLTLVDLPGMTKVPVGDQPKDIELQIRELILRFI
SNPNSIILAVTAANTDMATSEALKISREVDPDGRRTLAVITKLDLMDAGTDAMDVLMGRV
IPVKLGIIGVVNRSQLDINNKKSVTDSIRDEYAFLQKKYPSLANRNGTKYLARTLNRLLM
HHIRDCLPELKTRINVLAAQYQSLLNSYGEPVDDKSATLLQLITKFATEYCNTIEGTAKY
IETSELCGGARICYIFHETFGRTLESVDPLGGLNTIDILTAIRNATGPRPALFVPEVSFE
LLVKRQIKRLEEPSLRCVELVHEEMQRIIQHCSNYSTQELLRFPKLHDAIVEVVTCLLRK
RLPVTNEMVHNLVAIELAYINTKHPDFADACGLMNNNIEEQRRNRLARELPSAGSRDKLI
QDNRRETKNVPSAGGGIGDGGQEPTTGNWRGMLKTSKAEELLAEEKSKPIPIMPASPQKG
HAVNLLDVPVPVARKLSAREQRDCEVIERLIKSYFLIVRKNIQDSVPKAVMHFLVNHVKD
TLQSELVGQLYKSSLLDDLLTESEDMAQRRKEAADMLKALQGASQIIAEIRETHLW
NT seq 2151 nt   +upstreamnt  +downstreamnt
atggaggcgctgatcccggtcatcaataagctgcaggacgtcttcaacacagtgggtgcg
gacatcatccagctgcctcagatcgtcgtagtgggaacgcagagcagtgggaagagctca
gtgctggaaagcctagtgggcagggaccttcttcccagaggaactggtgtggtcacccgg
agacctctcattctgcagctagtccacgtttcaccagaagataaaagaaaaacaacagga
gaagaaaatggtaaatttcagagctggagagttgaagcagaagaatggggtaaatttctt
cacaccaaaaacaagctttacacagattttgatgaaattcgacaagaaattgaaaatgaa
actgaaagaatttcaggaaataataagggggtaagccctgagccaatccatctcaaggtt
ttctcgcccaacgttgtcaacctgacacttgtggatttaccgggaatgaccaaagtacct
gtaggcgatcagcccaaggacatcgagcttcagatcagagaacttattcttcggttcatc
agtaatcccaattccattatcctcgccgtcactgctgcaaatacagatatggcaacatca
gaagcactcaagatttccagagaggtagatccagatgggcgcagaactctagctgtaatc
actaaacttgatctcatggatgcgggtactgatgccatggatgtattgatgggaagggtt
attccagtcaagcttggaataattggagtagttaacagaagccaactggatattaacaat
aagaagagtgtaactgattcaatccgtgatgagtatgcttttcttcaaaagaagtaccca
tctctggccaacagaaatggaacaaagtatcttgctaggaccctgaataggttacttatg
catcatatcagagattgtttaccagagctgaaaacaagaataaatgtcttagctgctcag
tatcagtctcttctaaatagctatggtgaaccggtggatgataaaagtgctactttactc
cagcttattaccaaatttgccacagagtattgtaacacgattgaaggaaccgcaaagtac
attgaaacttctgagctatgcggtggtgctaggatttgttatattttccatgagactttc
gggcgaaccttagaatctgtggacccactaggtggccttaacactattgacatcctgact
gccatcagaaatgctactggcccccgtcctgctttatttgtgcctgaagtttcatttgag
ttactggtcaaacgtcagattaagcgtctagaagagcccagcctacggtgtgtggagctg
gtccatgaggagatgcagaggatcattcagcattgtagcaattacagcacacaggaattg
ttacggttccctaaacttcacgatgccatagttgaagtagtgacctgtcttcttcgtaaa
aggttgcccgtgacaaatgaaatggtgcataacttagtggcaattgagctagcgtatatc
aacacaaaacaccccgactttgctgatgcctgtgggctaatgaacaataatatagaggaa
caaagaagaaacaggctagcaagagagctgccttcagctggatcacgggacaagttaatt
caggacaacagaagagaaactaaaaatgtcccatctgcaggtggtgggattggagacggt
ggtcaggaaccaacaacaggcaactggagaggaatgctgaaaacttcaaaagctgaagaa
ttacttgctgaagaaaaatcaaaaccaattccaattatgccagcaagtccacagaaaggc
catgctgtcaatttgctagatgtgccagttccagttgcaagaaaactgtctgcccgagaa
cagcgagattgtgaggttattgaaagacttatcaaatcatattttctaattgtcagaaag
aatattcaagacagtgtcccaaaggcagtaatgcattttttggttaatcatgtgaaagat
actcttcagagtgaactggtagggcagctgtataagtcatccttattagatgaccttctg
actgaatccgaggacatggcccaacgaagaaaagaagcagcggatatgctgaaggcatta
caaggagccagtcaaattattgctgaaatccgagagactcatctttggtga

DBGET integrated database retrieval system