Mus musculus (house mouse): 75477 Help Entry 75477             CDS       T01002                                  Symbol Pfn3, 1700012P12Rik Name (RefSeq) profilin 3   KO K05759   profilin Organism mmu  Mus musculus (house mouse) Pathway mmu04015   Rap1 signaling pathway mmu04810   Regulation of actin cytoskeleton mmu05014   Amyotrophic lateral sclerosis mmu05132   Salmonella infection Brite KEGG Orthology (KO) [BR:mmu00001]  09130 Environmental Information Processing   09132 Signal transduction    04015 Rap1 signaling pathway     75477 (Pfn3)  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     75477 (Pfn3)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     75477 (Pfn3)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     75477 (Pfn3)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:mmu04131]     75477 (Pfn3)   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:mmu04812]     75477 (Pfn3)    04147 Exosome [BR:mmu04147]     75477 (Pfn3) Membrane trafficking [BR:mmu04131]  Others   Actin-binding proteins    Others     75477 (Pfn3) Cytoskeleton proteins [BR:mmu04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Profilin      75477 (Pfn3) Exosome [BR:mmu04147]  Exosomal proteins   Proteins found in most exosomes    75477 (Pfn3) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Profilin Motif Other DBs NCBI-GeneID:  75477 NCBI-ProteinID:  NP_083579 MGI:  2178800 Ensembl:  ENSMUSG00000044444 UniProt:  Q9DAD6 LinkDB All DBs Position 13:complement(55562501..55563045) Genome browser AA seq 137 aa AA seqDB search MSDWKGYISAVLRDQRIDDVAIVGHSDNRCVWASRPGGLLAAISPQEVGVLTGPDRHTFL QTGLSVAGRRCCVIRDYLLAEGDGVLDARTKGLDGRAICVGHTPRALLVLMGRRGVHGGI LNKTVHDLIGGLREQCS NT seq 414 nt NT seq  +upstreamnt  +downstreamnt atgagtgactggaagggctacatcagtgcagtgctgcgggatcagcggatcgatgacgtg gctatcgtgggccactcggacaatcgctgtgtgtgggcatcacggcctgggggtctgctg gctgccatctccccgcaggaggtgggtgtgctcaccgggccagaccggcacacctttctg cagacgggtctgagcgtggcaggccgccgctgctgcgttatccgtgactacctgctggcc gagggtgacggcgtactggatgcgcgcaccaaggggctagacgggcgtgcaatctgtgtg ggccacacgccacgggcgctcctggtgctcatgggcagacgaggcgtgcatggaggcatc ctcaataagacagtgcacgatctgattggtgggctgcgtgagcagtgctcttag

DBGET integrated database retrieval system