KEGG   Mus musculus (house mouse): 80883
Entry
80883             CDS       T01002                                 
Symbol
Ntng1, A930010C08Rik, AI853992, Lmnt1
Name
(RefSeq) netrin G1
  KO
K07522  netrin-G1
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04360  Axon guidance
mmu04514  Cell adhesion molecules
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    80883 (Ntng1)
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    80883 (Ntng1)
SSDB
Motif
Pfam: Laminin_N Laminin_EGF EGF_2
Other DBs
NCBI-GeneID: 80883
NCBI-ProteinID: NP_109624
MGI: 1934028
Ensembl: ENSMUSG00000059857
UniProt: Q8R4G0
LinkDB
Position
3:complement(109687366..110057291)
AA seq 539 aa
MYLSRFLSIHALWVTVSSVMQPYLFVWGHYDVCKSLIYTEEGKVWDYTACQPESTDMTKY
LKVKLDPPDITCGDPPESFCAMGNPYMCNNECDASTPELAHPPELMFDFEGRHPSTFWQS
ATWKEYPKPLQVNITLSWSKTIELTDNIVITFESGRPDQMILEKSLDYGRTWQPYQYYAT
DCLHAFHMDPKSVKDLSQHTVLEIICTEEYSTGYSTNSKIIHFEIKDRFAFFAGPRLRNM
ASLYGQLDTTKKLRDFFTVTDLRIRLLRPAVGEIFVDELHLARYFYAISDIKVRGRCKCN
LHATSCLYDNSKLTCECEHNTTGPDCGKCKKNYQGRPWSPGSYLPIPKGTANTCIPSISS
IGNCECFGHSNRCSYIDLLNTVICVSCKHNTRGQHCELCRLGYFRNASAQLDDENVCIEC
YCNPLGSIHDRCNGSGFCECKTGTTGPKCDECLPGNSWYYGCQPNVCDNELLHCQNGGTC
QNNVRCACPDAYTGILCEKLRCEEAGSCGSESGQGAPPRGSPALLLLTMLLGTAGPLVF
NT seq 1620 nt   +upstreamnt  +downstreamnt
atgtatttgtcaagattcctgtcgatccatgccctgtgggtgacagtgtcctctgtgatg
cagccctaccttttcgtgtggggacattatgatgtatgtaagagcctgatttacacagaa
gaaggcaaagtttgggattacacagcctgccagccggaatccacggacatgaccaagtat
ctgaaagtgaaactggaccctccggatattacctgtggagaccctccagagtccttctgt
gcaatgggcaacccttacatgtgcaataatgagtgtgatgcgagtacccctgaactggca
caccctcctgagctgatgtttgattttgaaggaagacatccctccacattttggcagtct
gctacttggaaggagtaccccaaacctctccaggttaacatcactctgtcttggagcaaa
accattgaactcacagacaacatagttattacctttgaatcggggcgtccagaccaaatg
atcctagagaaatctctcgactacggacgaacatggcagccctatcagtattatgccaca
gactgcctccatgcattccacatggacccgaaatccgtgaaggatttatctcagcacacg
gtcttggaaatcatttgcacggaagagtactccactgggtactccacgaatagcaaaata
atccacttcgagatcaaagacaggtttgcgtttttcgctggacctcggctacgaaatatg
gcttccctctatggacagctggatacaaccaagaaactcagagatttcttcactgtcaca
gacctgaggatcaggctgttgagacccgccgttggggaaatatttgtagatgaactacat
ttggcacgttacttttatgcgatctcagacataaaggtgcgaggaaggtgcaagtgcaac
ctgcatgccacttcgtgtttgtatgacaacagcaaactgacatgtgaatgtgagcacaac
actacaggtcccgactgtgggaaatgcaagaagaactaccagggccgaccttggagcccc
ggctcatacctccccatccccaaaggcaccgcaaacacctgtatccccagcatttccagt
atcggtaactgtgaatgcttcggccactccaatcggtgcagttatatcgatctgctaaac
acagtcatttgcgtgagctgtaaacacaacactagagggcagcactgtgagttatgcagg
ctgggctacttcagaaatgcttctgcacagctggacgatgagaatgtgtgcatagagtgt
tattgtaaccctttgggctcaatccatgatcgttgtaatggctcaggattttgtgagtgt
aagactggaacaacagggcctaaatgtgatgagtgtctgccaggaaattcctggtactac
ggctgtcaacctaatgtctgcgacaatgagctcctgcactgccagaatggagggacctgc
cagaacaatgtgcgctgcgcgtgcccagacgcctacaccggcatcctctgtgagaagcta
cggtgcgaagaggcgggcagctgtggctccgaatccggccagggagcacccccgcggggc
tccccagcactgctgctgctgaccatgctgctggggactgccggtcccctggtgttctag

DBGET integrated database retrieval system