Mycolicibacterium mucogenicum: C1S78_018820 Help Entry C1S78_018820      CDS       T07324                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism mmuc  Mycolicibacterium mucogenicum Pathway mmuc01100   Metabolic pathways mmuc01110   Biosynthesis of secondary metabolites Module mmuc_M00885   Meromycolic acid biosynthesis, initiation and elongation FAS II (KasA) mmuc_M00886   Meromycolic acid biosynthesis, initiation and elongation FAS II (KasA and KasB) Brite KEGG Orthology (KO) [BR:mmuc00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     C1S78_018820    00074 Mycolic acid biosynthesis     C1S78_018820   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     C1S78_018820 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  QPG67592 UniProt:  A0A8H2JFB5 LinkDB All DBs Position 3871634..3871894 Genome browser AA seq 86 aa AA seqDB search METAESVSTGLAKIMQDDMGVDIKRVTRESRLINDVGLDSVAFAVGMVAIEDRFGVALSE EDLLSSETVGDLEDAIAAKLPTAQRS NT seq 261 nt NT seq  +upstreamnt  +downstreamnt atggagacagctgaatcggtaagcactggcttggccaagatcatgcaggacgacatgggc gtggacatcaaacgcgtcacccgcgaatcccggctcatcaacgatgtcggtttggactcg gtggctttcgcagtgggcatggtcgcgatcgaagaccgcttcggcgtcgcattgtccgag gaagacctgctgagcagcgaaaccgtcggcgacctcgaagacgccatcgccgcgaaactg cctaccgcccaacgctcatga

DBGET integrated database retrieval system