Mycolicibacterium mucogenicum: C1S78_020040 Help Entry C1S78_020040      CDS       T07324                                  Symbol mrx1 Name (GenBank) mycoredoxin Mrx1   KO K18917   mycoredoxin [EC:1.20.4.3] Organism mmuc  Mycolicibacterium mucogenicum Brite KEGG Orthology (KO) [BR:mmuc00001]  09190 Not Included in Pathway or Brite   09191 Unclassified: metabolism    99980 Enzymes with EC numbers     C1S78_020040 (mrx1) Enzymes [BR:mmuc01000]  1. Oxidoreductases   1.20  Acting on phosphorus or arsenic in donors    1.20.4  With disulfide as acceptor     1.20.4.3  mycoredoxin      C1S78_020040 (mrx1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Glutaredoxin Thioredoxin_2 GST_N_2 Thioredoxin Glrx-like GST_N_3 Motif Other DBs NCBI-ProteinID:  QPG67803 UniProt:  A0A8E4R500 LinkDB All DBs Position 4117315..4117551 Genome browser AA seq 78 aa AA seqDB search MSALIMYSTTWCGYCKRLKTALKAEGISYTEIDIEQDPAAAEFVGSVNNGNHVVPTVKFP DGSTLTNPSIKDVKAKLN NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagtgcactgatcatgtacagcacgacctggtgcggctactgcaagcggctcaagacc gcgctgaaggccgaaggcatctcctacaccgagatcgacatcgagcaggacccggcggcc gccgagttcgtcggttcggtcaacaacggcaaccatgtggttccgacggtgaagttcccc gacggctcgacgctgaccaaccccagcatcaaggacgtcaaagccaaactgaattag

DBGET integrated database retrieval system