Microcebus murinus (gray mouse lemur): 105858138 Help Entry 105858138         CDS       T07238                                  Symbol LTA Name (RefSeq) lymphotoxin-alpha   KO K05468   lymphotoxin alpha (TNF superfamily, member 1) Organism mmur  Microcebus murinus (gray mouse lemur) Pathway mmur04060   Cytokine-cytokine receptor interaction mmur04061   Viral protein interaction with cytokine and cytokine receptor mmur04064   NF-kappa B signaling pathway mmur04668   TNF signaling pathway mmur04940   Type I diabetes mellitus mmur05166   Human T-cell leukemia virus 1 infection mmur05168   Herpes simplex virus 1 infection Brite KEGG Orthology (KO) [BR:mmur00001]  09130 Environmental Information Processing   09132 Signal transduction    04064 NF-kappa B signaling pathway     105858138 (LTA)    04668 TNF signaling pathway     105858138 (LTA)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     105858138 (LTA)    04061 Viral protein interaction with cytokine and cytokine receptor     105858138 (LTA)  09160 Human Diseases   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     105858138 (LTA)    05168 Herpes simplex virus 1 infection     105858138 (LTA)   09167 Endocrine and metabolic disease    04940 Type I diabetes mellitus     105858138 (LTA)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:mmur04052]     105858138 (LTA) Cytokines and neuropeptides [BR:mmur04052]  Cytokines   Tumor necrosis fators    105858138 (LTA) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  TNF Motif Other DBs NCBI-GeneID:  105858138 NCBI-ProteinID:  XP_012596518 Ensembl:  ENSMICG00000036584 UniProt:  A0A8B7EQP9 LinkDB All DBs Position 6:1458952..1461427 Genome browser AA seq 205 aa AA seqDB search MTPPGRLYLPRVHGTPLHLLLLVLLLALLPATQELPGVGLAPPAAQTAHQHPQKHFTHST LKPAAHLIGDPSKQDSLRWRANTDRAFLQHGFSLSNNSLLVPASGIYFVYSQVVFSGQAC PPEATPTPLYLAHEVQLFSSQYPFHVPLLSAQKTVCPGPQGPWLHSMYHGAAFLLTQGDQ LSTHTDGIPHLLLSPSSVFFGAFAL NT seq 618 nt NT seq  +upstreamnt  +downstreamnt atgacaccacctggacgtctctacctcccgagggtgcatggcacccccctccacctcctc cttctggttctgctgctggccctgctgcctgcgacccaggagctccctggtgttggcctc gcacctccagctgcccagactgcccatcagcacccccagaagcacttcacccacagcacc ctcaaacctgctgctcacctcattggagaccccagcaagcaagactcactacgctggaga gcaaacacggaccgcgccttcctgcagcatggcttctctctgagcaacaactccctcctg gtccctgccagtggtatctacttcgtctactcccaggtggtcttctcagggcaagcctgc ccccctgaggccacccccacccctctctacctggcccatgaagtccagctcttctcctcc cagtaccccttccacgtgcctctcctcagcgcccagaagaccgtgtgcccagggccgcag ggaccttggctgcactccatgtaccacggggcggcgttcctgctcacccagggagaccag ctgtccactcacacagacggcatcccccacctactcctcagtcctagtagcgtcttcttt ggagcctttgctttgtag

DBGET integrated database retrieval system