Microcebus murinus (gray mouse lemur): 105858292 Help Entry 105858292         CDS       T07238                                  Name (RefSeq) histone H2B type 1-like   KO K11252   histone H2B Organism mmur  Microcebus murinus (gray mouse lemur) Pathway mmur04613   Neutrophil extracellular trap formation mmur05034   Alcoholism mmur05203   Viral carcinogenesis mmur05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:mmur00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     105858292  09160 Human Diseases   09161 Cancer: overview    05203 Viral carcinogenesis     105858292   09163 Immune disease    05322 Systemic lupus erythematosus     105858292   09165 Substance dependence    05034 Alcoholism     105858292  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:mmur03036]     105858292   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mmur04147]     105858292 Chromosome and associated proteins [BR:mmur03036]  Eukaryotic type   Nucleosome assembly factors    Histones     105858292 Exosome [BR:mmur04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    105858292 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone CBFD_NFYB_HMF YscO-like TFIID_20kDa NFACT-R_2 Motif Other DBs NCBI-GeneID:  105858292 NCBI-ProteinID:  XP_012596776 LinkDB All DBs Position 14:41152777..41155449 Genome browser AA seq 142 aa AA seqDB search MPEPAKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAM GIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVT KYTSSKKEKRSRKETSPLSMET NT seq 429 nt NT seq  +upstreamnt  +downstreamnt atgccggaacctgccaagtccgctcctgccccaaagaagggctccaagaaggcggtgacc aaagcccaaaagaaggatgggaagaagcgcaagcgcagccgcaaggagagctactccgtg tacgtgtacaaggtgctgaagcaggtccaccccgacaccggcatctcctcgaaggccatg ggcatcatgaactcgttcgtcaacgacatcttcgagcgcatcgcgggcgaggcctctcgc ctggcgcattacaacaagcgctcgaccatcacctccagggagatccagacggcggtgcgc ctgctgctgccgggagagctggccaagcacgccgtgtccgagggcaccaaggctgttacc aagtacaccagctctaagaaggagaaaaggtccaggaaagaaacatccccgctatctatg gaaacttaa

DBGET integrated database retrieval system