Microcebus murinus (gray mouse lemur): 105858295 Help Entry 105858295         CDS       T07238                                  Name (RefSeq) histone H3.1   KO K11253   histone H3 Organism mmur  Microcebus murinus (gray mouse lemur) Pathway mmur04613   Neutrophil extracellular trap formation mmur05034   Alcoholism mmur05202   Transcriptional misregulation in cancer mmur05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:mmur00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     105858295  09160 Human Diseases   09161 Cancer: overview    05202 Transcriptional misregulation in cancer     105858295   09163 Immune disease    05322 Systemic lupus erythematosus     105858295   09165 Substance dependence    05034 Alcoholism     105858295  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:mmur03036]     105858295   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mmur04147]     105858295 Chromosome and associated proteins [BR:mmur03036]  Eukaryotic type   Nucleosome assembly factors    Histones     105858295 Exosome [BR:mmur04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    105858295 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone CENP-T_C CENP-S CBFD_NFYB_HMF PAF YebU_pre-PUA_dom TFIID-31kDa Motif Other DBs NCBI-GeneID:  105858295 NCBI-ProteinID:  XP_012596778 Ensembl:  ENSMICG00000047469 UniProt:  A0A8C5XZE5 LinkDB All DBs Position 14:complement(41095507..41099278) Genome browser AA seq 136 aa AA seqDB search MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTI MPKDIQLARRIRGERA NT seq 411 nt NT seq  +upstreamnt  +downstreamnt atggctcgcacgaagcagacagcccgcaagtccaccggcgggaaggcgccgcgcaagcag ctcgccaccaaggcggcccgcaagagcgcgccggccaccggcggcgtgaagaagccccac cgctaccggcctggcaccgtggccctgcgcgagatccgccgctaccagaagtctacagag ctgctgatccgcaaactgccattccagcgcttggtgcgtgagatcgcgcaggatttcaag accgacctacgtttccagagctcggcagtgatggcgctgcaggaggcctgcgaggcctac ctggtggggctctttgaggacaccaacctgtgcgccatccacgccaagcgcgtcaccatc atgcccaaggacatccagctcgctcgccgaattcgtggggagagggcgtaa

DBGET integrated database retrieval system