Microcebus murinus (gray mouse lemur): 105858302 Help Entry 105858302         CDS       T07238                                  Name (RefSeq) histone H2B type 1   KO K11252   histone H2B Organism mmur  Microcebus murinus (gray mouse lemur) Pathway mmur04613   Neutrophil extracellular trap formation mmur05034   Alcoholism mmur05203   Viral carcinogenesis mmur05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:mmur00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     105858302  09160 Human Diseases   09161 Cancer: overview    05203 Viral carcinogenesis     105858302   09163 Immune disease    05322 Systemic lupus erythematosus     105858302   09165 Substance dependence    05034 Alcoholism     105858302  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:mmur03036]     105858302   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mmur04147]     105858302 Chromosome and associated proteins [BR:mmur03036]  Eukaryotic type   Nucleosome assembly factors    Histones     105858302 Exosome [BR:mmur04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    105858302 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone CBFD_NFYB_HMF YscO-like TFIID_20kDa Motif Other DBs NCBI-GeneID:  105858302 NCBI-ProteinID:  XP_012596787 Ensembl:  ENSMICG00000045211 UniProt:  A0A8C5Y4W5 LinkDB All DBs Position 14:complement(41116381..41116880) Genome browser AA seq 126 aa AA seqDB search MPEPAKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAM GIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVT KYTSSK NT seq 381 nt NT seq  +upstreamnt  +downstreamnt atgcctgaaccggccaagtccgctcctgctccgaagaagggctccaagaaagctgtgacc aaggcgcagaagaaggatggtaagaagcgcaagcgcagccggaaggagagttactccgtg tacgtgtacaaagtactgaagcaagtccatccggatactggcatctcttcaaaggccatg ggcattatgaattccttcgtgaacgacatcttcgagcgcatcgcgggtgaggcgtctcgc ctggcgcattacaacaagcgctcgaccatcacctccagggagatccagacggcggtgcgc ctgctgctgccgggagagctggccaagcacgccgtgtccgagggcaccaaggctgtcacc aagtacaccagctccaagtaa

DBGET integrated database retrieval system