Microcebus murinus (gray mouse lemur): 105858304 Help Entry 105858304         CDS       T07238                                  Name (RefSeq) histone H2B type 1   KO K11252   histone H2B Organism mmur  Microcebus murinus (gray mouse lemur) Pathway mmur04613   Neutrophil extracellular trap formation mmur05034   Alcoholism mmur05203   Viral carcinogenesis mmur05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:mmur00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     105858304  09160 Human Diseases   09161 Cancer: overview    05203 Viral carcinogenesis     105858304   09163 Immune disease    05322 Systemic lupus erythematosus     105858304   09165 Substance dependence    05034 Alcoholism     105858304  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:mmur03036]     105858304   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mmur04147]     105858304 Chromosome and associated proteins [BR:mmur03036]  Eukaryotic type   Nucleosome assembly factors    Histones     105858304 Exosome [BR:mmur04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    105858304 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone CBFD_NFYB_HMF YscO-like TFIID_20kDa Motif Other DBs NCBI-GeneID:  105858304 NCBI-ProteinID:  XP_012596788 Ensembl:  ENSMICG00000047957 UniProt:  A0A8C5Y4W5 LinkDB All DBs Position 14:41099907..41100422 Genome browser AA seq 126 aa AA seqDB search MPEPAKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAM GIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVT KYTSSK NT seq 381 nt NT seq  +upstreamnt  +downstreamnt atgcctgagccagccaaatccgctcctgcgcctaagaagggctccaagaaggctgtgacc aaagcccagaagaaggacgggaagaaacgcaagcgcagccggaaggagagctactccgtg tacgtgtacaaagtactgaagcaagtccatccggatactggcatctcttcaaaggccatg ggcattatgaattccttcgtgaacgacatcttcgagcgcatcgcgggtgaggcgtctcgc ctggcgcattacaacaagcgctcgaccatcacctccagggagatccagacggcggtgcgc ctgctgctgccgggagagctggccaagcacgccgtgtccgagggcaccaaggctgttacc aagtacaccagctccaagtag

DBGET integrated database retrieval system