Microcebus murinus (gray mouse lemur): 105858731 Help Entry 105858731         CDS       T07238                                  Name (RefSeq) histone H2B type 2-E-like   KO K11252   histone H2B Organism mmur  Microcebus murinus (gray mouse lemur) Pathway mmur04613   Neutrophil extracellular trap formation mmur05034   Alcoholism mmur05203   Viral carcinogenesis mmur05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:mmur00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     105858731  09160 Human Diseases   09161 Cancer: overview    05203 Viral carcinogenesis     105858731   09163 Immune disease    05322 Systemic lupus erythematosus     105858731   09165 Substance dependence    05034 Alcoholism     105858731  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:mmur03036]     105858731   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mmur04147]     105858731 Chromosome and associated proteins [BR:mmur03036]  Eukaryotic type   Nucleosome assembly factors    Histones     105858731 Exosome [BR:mmur04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    105858731 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone CBFD_NFYB_HMF YscO-like TFIID_20kDa ARM_TT21 Motif Other DBs NCBI-GeneID:  105858731 NCBI-ProteinID:  XP_012597517 Ensembl:  ENSMICG00000041609 UniProt:  A0A8B7ER07 LinkDB All DBs Position 14:22996084..22996539 Genome browser AA seq 126 aa AA seqDB search MPEPAKSAPASKKGSKKAVTKAQKKDGKKRKRSRKESYSIYVYKVLKQVHPDTGISSKAM GIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVT KYTSSK NT seq 381 nt NT seq  +upstreamnt  +downstreamnt atgcctgagccggctaaatctgctccggcctcaaaaaagggctctaagaaagccgtgacc aaggctcagaaaaaagatggcaagaagcgcaagcgcagccgcaaggagagctattctatc tacgtgtataaggtgctgaagcaggtccacccggacaccggcatctcctcgaaggccatg ggcatcatgaattccttcgtcaacgacatcttcgagcgcatcgcgggcgaggcctctcgc ctggcgcattacaacaagcgctcgaccatcacctccagggagatccagacggcggtgcgc ctgctgctgccgggagagctggccaagcacgccgtgtccgagggcaccaaggccgtcacc aagtacaccagctccaagtga

DBGET integrated database retrieval system