Microcebus murinus (gray mouse lemur): 105858879 Help Entry 105858879         CDS       T07238                                  Name (RefSeq) histone H2A-Bbd type 2/3   KO K11251   histone H2A Organism mmur  Microcebus murinus (gray mouse lemur) Pathway mmur03082   ATP-dependent chromatin remodeling mmur04217   Necroptosis mmur04613   Neutrophil extracellular trap formation mmur05034   Alcoholism mmur05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:mmur00001]  09120 Genetic Information Processing   09126 Chromosome    03082 ATP-dependent chromatin remodeling     105858879  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     105858879  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     105858879  09160 Human Diseases   09163 Immune disease    05322 Systemic lupus erythematosus     105858879   09165 Substance dependence    05034 Alcoholism     105858879  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:mmur03036]     105858879   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mmur04147]     105858879 Chromosome and associated proteins [BR:mmur03036]  Eukaryotic type   Nucleosome assembly factors    Histones     105858879 Exosome [BR:mmur04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    105858879 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone CBFD_NFYB_HMF Cdc6_lid HIRA_B DUF7555 Motif Other DBs NCBI-GeneID:  105858879 NCBI-ProteinID:  XP_012597734 LinkDB All DBs Position X:83312316..83312905 Genome browser AA seq 116 aa AA seqDB search MSSMPGKQSRRRSSRRQSQTRSRTARAELAFSVSHMERLLREGHYTQRLSSSAPVFLAAI VQYLTAKVLELAGNEAQKSGRRRITPELVDMAVHNNPLLSGFFGTTTISQVAPAQE NT seq 351 nt NT seq  +upstreamnt  +downstreamnt atgtccagcatgccgggcaagcagagccgtcgaaggtcgtcccgtcgtcagagccagacc cgctctcgcacagccagagccgagctggcgttctcggtgagccacatggagcgccttctg cgggagggccactacacccagcggctgagctcctctgccccagttttcctagctgccatc gtccagtacctgacggccaaggtcctggagctggcgggcaacgaggcccagaagagcggc aggaggcgcatcaccccggagctggtggacatggctgtccacaacaacccgctgctcagc ggcttctttgggaccactaccatctcccaggttgccccagcgcaggagtag

DBGET integrated database retrieval system