Microcebus murinus (gray mouse lemur): 105859435 Help Entry 105859435         CDS       T07238                                  Symbol RAB5C Name (RefSeq) ras-related protein Rab-5C   KO K07889   Ras-related protein Rab-5C Organism mmur  Microcebus murinus (gray mouse lemur) Pathway mmur04014   Ras signaling pathway mmur04137   Mitophagy - animal mmur04144   Endocytosis mmur04145   Phagosome mmur04148   Efferocytosis mmur04962   Vasopressin-regulated water reabsorption mmur05132   Salmonella infection mmur05146   Amoebiasis mmur05152   Tuberculosis Brite KEGG Orthology (KO) [BR:mmur00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     105859435 (RAB5C)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     105859435 (RAB5C)    04145 Phagosome     105859435 (RAB5C)    04137 Mitophagy - animal     105859435 (RAB5C)    04148 Efferocytosis     105859435 (RAB5C)  09150 Organismal Systems   09155 Excretory system    04962 Vasopressin-regulated water reabsorption     105859435 (RAB5C)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     105859435 (RAB5C)    05152 Tuberculosis     105859435 (RAB5C)   09174 Infectious disease: parasitic    05146 Amoebiasis     105859435 (RAB5C)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:mmur04131]     105859435 (RAB5C)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mmur04147]     105859435 (RAB5C)    04031 GTP-binding proteins [BR:mmur04031]     105859435 (RAB5C) Membrane trafficking [BR:mmur04131]  Endocytosis   Rab GTPases and associated proteins    Rab GTPases     105859435 (RAB5C)  Endosome - Lysosome transport     105859435 (RAB5C) Exosome [BR:mmur04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    105859435 (RAB5C)   Exosomal proteins of other body fluids (saliva and urine)    105859435 (RAB5C)   Exosomal proteins of colorectal cancer cells    105859435 (RAB5C)   Exosomal proteins of bladder cancer cells    105859435 (RAB5C) GTP-binding proteins [BR:mmur04031]  Small (monomeric) G-proteins   Rab Family    Rab5/17/22/31 [OT]     105859435 (RAB5C) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 Gtr1_RagA RsgA_GTPase AAA_16 Motif Other DBs NCBI-GeneID:  105859435 NCBI-ProteinID:  XP_012598696 Ensembl:  ENSMICG00000041608 UniProt:  A0A8C5VSZ9 LinkDB All DBs Position 16:complement(30707548..30730898) Genome browser AA seq 216 aa AA seqDB search MAGRGGAARPNGPAAGNKICQFKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLT QTVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNTDTFARAKNWVKELQ RQASPNIVIALAGNKADLATKRAVEFQEAQAYADDNSLLFMETSAKTAMNVNEIFMAIAK KLPKNEPQNAAGAPGRNRGVDLQENNPASRSQCCSN NT seq 651 nt NT seq  +upstreamnt  +downstreamnt atggcgggtcggggaggcgcagcacgacccaacggaccagctgctgggaacaagatctgt cagtttaagctggttctgctgggggagtctgcggtgggcaaatccagcctcgtcctccgc ttcgtcaagggacaattccatgagtaccaggagagcacaattggagcggccttcctcaca cagactgtctgcttggacgacacaacggtcaagtttgagatctgggacacagctggacag gagcggtatcacagcctggcccccatgtactaccggggggcccaagctgccatcgtggtc tatgacatcaccaacacagatacatttgcacgggccaagaactgggtgaaggagttacag cggcaggccagccccaacatcgtcattgcgctcgcgggtaacaaggcggacctggccacc aagagagctgtggaattccaggaagcgcaagcctatgcagacgacaacagtttgctgttc atggagacatcagcaaagactgcaatgaatgtgaatgaaattttcatggcaatagctaag aagcttcccaagaatgagccccagaatgcagctggtgctccaggccggaaccgaggagtg gacctccaggagaacaacccagccagccggagccagtgctgcagcaactga

DBGET integrated database retrieval system