Microcebus murinus (gray mouse lemur): 105860490 Help Entry 105860490         CDS       T07238                                  Name (RefSeq) platelet basic protein-like   KO K10029   platelet basic protein Organism mmur  Microcebus murinus (gray mouse lemur) Pathway mmur04060   Cytokine-cytokine receptor interaction mmur04061   Viral protein interaction with cytokine and cytokine receptor mmur04062   Chemokine signaling pathway Brite KEGG Orthology (KO) [BR:mmur00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     105860490    04061 Viral protein interaction with cytokine and cytokine receptor     105860490  09150 Organismal Systems   09151 Immune system    04062 Chemokine signaling pathway     105860490  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:mmur04052]     105860490 Cytokines and neuropeptides [BR:mmur04052]  Cytokines   Chemokines    105860490 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL8 Motif Other DBs NCBI-GeneID:  105860490 NCBI-ProteinID:  XP_012600751 LinkDB All DBs Position 26:13816062..13817306 Genome browser AA seq 119 aa AA seqDB search MGLRPSARASCARARPARVLQLLLLLSLLLTTVVPTYVREGKHSDNVLCVGLQCRCERTL SWIHPSFIRHVEIANPGEHCSNVEVIATLKSGRKVCLNPDSPVIKKTVYEMMDGDDEDE NT seq 360 nt NT seq  +upstreamnt  +downstreamnt atgggcctccgccccagcgcccgcgcctcctgtgccagggccaggcccgcgcgcgtcctg cagctgctgctgctgctgtcactgctcctgaccaccgtggttcccacctacgtcagggaa ggtaagcattccgacaatgtcctgtgtgttgggctgcaatgcaggtgtgagaggacgctc tcttggattcatcccagctttattcgtcatgtggaaatagccaacccgggagaacattgc agcaacgtcgaagtgatagccacgctgaaaagtggaaggaaagtctgcctgaacccagac tccccggtgatcaagaaaacagtctatgaaatgatggatggtgatgacgaggatgagtga

DBGET integrated database retrieval system