Microcebus murinus (gray mouse lemur): 105861171 Help Entry 105861171         CDS       T07238                                  Symbol HMGB1 Name (RefSeq) high mobility group protein B1   KO K10802   high mobility group protein B1 Organism mmur  Microcebus murinus (gray mouse lemur) Pathway mmur03410   Base excision repair mmur04140   Autophagy - animal mmur04217   Necroptosis mmur04613   Neutrophil extracellular trap formation Brite KEGG Orthology (KO) [BR:mmur00001]  09120 Genetic Information Processing   09124 Replication and repair    03410 Base excision repair     105861171 (HMGB1)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     105861171 (HMGB1)   09143 Cell growth and death    04217 Necroptosis     105861171 (HMGB1)  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     105861171 (HMGB1)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:mmur03036]     105861171 (HMGB1)    03400 DNA repair and recombination proteins [BR:mmur03400]     105861171 (HMGB1)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mmur04147]     105861171 (HMGB1) Chromosome and associated proteins [BR:mmur03036]  Eukaryotic type   Nucleosome assembly factors    HMG (high mobility group) proteins     105861171 (HMGB1) DNA repair and recombination proteins [BR:mmur03400]  Eukaryotic type   SSBR (single strand breaks repair)    BER (base exicision repair)     Other BER factors      105861171 (HMGB1)    MMR (mismatch excision repair)     Other MMR factors      105861171 (HMGB1) Exosome [BR:mmur04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    105861171 (HMGB1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  HMG_box_2 HMG_box HMG_WDHD1 NOA36 HMG_box_5 Nop14 Motif Other DBs NCBI-GeneID:  105861171 NCBI-ProteinID:  XP_012601980 Ensembl:  ENSMICG00000007144 UniProt:  A0A8B7F3Z0 LinkDB All DBs Position 13:75477089..75482005 Genome browser AA seq 215 aa AA seqDB search MGKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKF EDMAKADKARYEREMKTYIPPKGETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGL SIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAKGKPDAAKKGVVKAEK SKKKKEEEEDEEDEEDEEEEEDEEDEDEEEDDDDE NT seq 648 nt NT seq  +upstreamnt  +downstreamnt atgggcaaaggagatcctaagaagccgagaggcaaaatgtcatcatatgcattctttgtg caaacttgccgggaggagcacaagaagaagcacccagatgcttcagtcaacttctcagag ttttctaagaagtgctcagagaggtggaagaccatgtctgctaaagagaaaggaaagttt gaagatatggcaaaggcggacaaggcccgttatgaaagagaaatgaaaacctatatccct cctaaaggggaaacaaaaaagaagttcaaggatcccaatgcacccaagaggcctccttcg gcctttttcttgttctgttctgagtatcgccctaaaatcaaaggagaacatcctggcctt tccattggtgatgttgcaaagaaactgggagagatgtggaataacactgctgcagatgat aagcagccttatgaaaagaaggctgcaaagctgaaggaaaagtatgaaaaggatattgct gcataccgagctaaaggaaagcctgatgcagcaaaaaagggagtcgtcaaggctgaaaaa agcaagaaaaagaaggaagaggaggaagatgaggaagatgaagaggatgaagaggaggag gaagatgaagaagatgaagatgaagaagaagatgatgatgatgaataa

DBGET integrated database retrieval system