Microcebus murinus (gray mouse lemur): 105861915 Help Entry 105861915         CDS       T07238                                  Name (RefSeq) histone H3.3 type 2-like   KO K11253   histone H3 Organism mmur  Microcebus murinus (gray mouse lemur) Pathway mmur04613   Neutrophil extracellular trap formation mmur05034   Alcoholism mmur05202   Transcriptional misregulation in cancer mmur05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:mmur00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     105861915  09160 Human Diseases   09161 Cancer: overview    05202 Transcriptional misregulation in cancer     105861915   09163 Immune disease    05322 Systemic lupus erythematosus     105861915   09165 Substance dependence    05034 Alcoholism     105861915  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:mmur03036]     105861915   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mmur04147]     105861915 Chromosome and associated proteins [BR:mmur03036]  Eukaryotic type   Nucleosome assembly factors    Histones     105861915 Exosome [BR:mmur04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    105861915 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone CENP-S CBFD_NFYB_HMF CENP-T_C PAF Motif Other DBs NCBI-GeneID:  105861915 NCBI-ProteinID:  XP_012603288 LinkDB All DBs Position 12:9911301..9913477 Genome browser AA seq 136 aa AA seqDB search MARTKQTARSAGVGKAPRKPLATKASGKRAPPLGGLKKPHRYRPGIVALREIRKFQKSTD LLIRKLPFQRLVREIAQAIHPDLRFQSAAVGALQEACEAYLVGLFEDTNLCALHAKRVTI MPKDMQLARRIRGERT NT seq 411 nt NT seq  +upstreamnt  +downstreamnt atggcgcgcaccaagcagaccgcgcgctctgccggcgtgggcaaagcgccccgcaagccg ctggccaccaaggcctccggcaagagggctccccctctgggcgggctgaagaagccccac cgctacaggcccggcatagtggcgctccgcgaaatccgaaagttccagaaatccacggat ctcctcattcgcaagctgcccttccagcgcctggtgcgggaaatcgctcaggccatccac cccgacctgcgcttccagagcgccgcggtgggcgctttgcaggaggcctgcgaggcctac ctggtgggacttttcgaggacaccaacttgtgtgcgctccacgccaagcgtgtcaccatc atgccgaaagacatgcagctggcgcgccgcattcgcggagagcgtacttga

DBGET integrated database retrieval system