Microcebus murinus (gray mouse lemur): 105862798 Help Entry 105862798         CDS       T07238                                  Name (RefSeq) transcription factor Maf-like   KO K09035   transcription factor Maf Organism mmur  Microcebus murinus (gray mouse lemur) Pathway mmur04658   Th1 and Th2 cell differentiation mmur05202   Transcriptional misregulation in cancer mmur05321   Inflammatory bowel disease Brite KEGG Orthology (KO) [BR:mmur00001]  09150 Organismal Systems   09151 Immune system    04658 Th1 and Th2 cell differentiation     105862798  09160 Human Diseases   09161 Cancer: overview    05202 Transcriptional misregulation in cancer     105862798   09163 Immune disease    05321 Inflammatory bowel disease     105862798  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03000 Transcription factors [BR:mmur03000]     105862798 Transcription factors [BR:mmur03000]  Eukaryotic type   Basic leucine zipper (bZIP)    AP-1(-like) components, Maf     105862798 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  bZIP_Maf bZIP_1 bZIP_2 ZapB DUF1192 HOOK vATP-synt_E KASH_CCD Spc24 CC149 GAS JIP_LZII Nipped-B_C DUF4407 Seryl_tRNA_N DUF1635 FapA MbeD_MobD Motif Other DBs NCBI-GeneID:  105862798 NCBI-ProteinID:  XP_012604791 LinkDB All DBs Position 20:49869790..49900063 Genome browser AA seq 115 aa AA seqDB search MSVRELNRQLRGVSKEEVIRLKQKRRTLKNRGYAQSCRFKRVQQRHVLESEKNQLLQQVD HLKQEISRLVRERDAYKEKYEKLVSSGFRENGSSSDNPSSPEFFMYPRESSTSVM NT seq 348 nt NT seq  +upstreamnt  +downstreamnt atgtcggtgcgcgagctgaaccgccagctgcgcggggtcagcaaggaggaggtgatccgg ctgaagcagaagaggcggaccctgaaaaaccgcggctatgcccagtcctgccgcttcaag agggtgcagcagaggcacgtcctggagtccgagaagaaccagctgctgcagcaagtcgac cacctcaagcaggagatctccaggctggtgcgcgagagggacgcgtacaaggagaagtac gagaagttggtgagcagcggcttccgagaaaacggctcgagcagcgacaacccgtcctct cccgagtttttcatgtacccaagggaatcctctacatcagtgatgtga

DBGET integrated database retrieval system