Microcebus murinus (gray mouse lemur): 105864957 Help Entry 105864957         CDS       T07238                                  Symbol RAB5B Name (RefSeq) ras-related protein Rab-5B   KO K07888   Ras-related protein Rab-5B Organism mmur  Microcebus murinus (gray mouse lemur) Pathway mmur04014   Ras signaling pathway mmur04137   Mitophagy - animal mmur04144   Endocytosis mmur04145   Phagosome mmur04148   Efferocytosis mmur04962   Vasopressin-regulated water reabsorption mmur05132   Salmonella infection mmur05146   Amoebiasis mmur05152   Tuberculosis Brite KEGG Orthology (KO) [BR:mmur00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     105864957 (RAB5B)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     105864957 (RAB5B)    04145 Phagosome     105864957 (RAB5B)    04137 Mitophagy - animal     105864957 (RAB5B)    04148 Efferocytosis     105864957 (RAB5B)  09150 Organismal Systems   09155 Excretory system    04962 Vasopressin-regulated water reabsorption     105864957 (RAB5B)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     105864957 (RAB5B)    05152 Tuberculosis     105864957 (RAB5B)   09174 Infectious disease: parasitic    05146 Amoebiasis     105864957 (RAB5B)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:mmur04131]     105864957 (RAB5B)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mmur04147]     105864957 (RAB5B)    04031 GTP-binding proteins [BR:mmur04031]     105864957 (RAB5B) Membrane trafficking [BR:mmur04131]  Endocytosis   Rab GTPases and associated proteins    Rab GTPases     105864957 (RAB5B)  Endosome - Lysosome transport     105864957 (RAB5B) Exosome [BR:mmur04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    105864957 (RAB5B)   Exosomal proteins of other body fluids (saliva and urine)    105864957 (RAB5B)   Exosomal proteins of colorectal cancer cells    105864957 (RAB5B)   Exosomal proteins of melanoma cells    105864957 (RAB5B) GTP-binding proteins [BR:mmur04031]  Small (monomeric) G-proteins   Rab Family    Rab5/17/22/31 [OT]     105864957 (RAB5B) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 Gtr1_RagA RsgA_GTPase AAA_16 Motif Other DBs NCBI-GeneID:  105864957 NCBI-ProteinID:  XP_012608633 Ensembl:  ENSMICG00000011086 UniProt:  A0A8C5W3T7 LinkDB All DBs Position 7:complement(81146594..81169827) Genome browser AA seq 215 aa AA seqDB search MTSRSTARPNGQPQASKICQFKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLTQ SVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNQETFARAKTWVKELQR QASPSIVIALAGNKADLANKRMVEYEEAQAYADDNSLLFMETSAKTAMNVNDLFLAIAKK LPKSEPQNLGGAACRSRGVDLHEQSQQNKSQCCSN NT seq 648 nt NT seq  +upstreamnt  +downstreamnt atgactagcagaagcacagccaggcccaatgggcagccccaggccagcaaaatatgccag ttcaaattggtcctgctaggagaatctgcagtggggaagtcaagcctggtattacgtttt gtcaaagggcagttccatgagtaccaggagagtaccattggagcggcctttctcacccag tccgtttgtctagatgacacaacagtcaagtttgagatctgggacacagctgggcaggag cgataccacagcttagcccctatgtactataggggtgcccaggctgcaatcgtggtttat gacattactaatcaggaaacctttgcccgagcaaagacatgggtaaaggaactacagcga caggcaagtcccagcatcgttattgccttggcagggaacaaagctgacctggccaacaag cgcatggtggagtatgaagaggcccaggcatatgcagatgacaacagcttattgtttatg gagacttcagccaagactgctatgaacgtgaatgatctcttcctggcaatagctaagaag ttgccaaagagtgaaccccagaatctggggggtgcagcatgccgaagccggggtgtggat ctccatgaacagtcccagcagaacaagagccagtgttgtagcaactga

DBGET integrated database retrieval system