Microcebus murinus (gray mouse lemur): 105865929 Help Entry 105865929         CDS       T07238                                  Symbol GHRH Name (RefSeq) somatoliberin isoform X1   KO K05260   growth hormone-releasing hormone Organism mmur  Microcebus murinus (gray mouse lemur) Pathway mmur04080   Neuroactive ligand-receptor interaction mmur04081   Hormone signaling mmur04935   Growth hormone synthesis, secretion and action Brite KEGG Orthology (KO) [BR:mmur00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04080 Neuroactive ligand-receptor interaction     105865929 (GHRH)    04081 Hormone signaling     105865929 (GHRH)  09150 Organismal Systems   09152 Endocrine system    04935 Growth hormone synthesis, secretion and action     105865929 (GHRH)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:mmur04052]     105865929 (GHRH) Cytokines and neuropeptides [BR:mmur04052]  Neuropeptides   GPCR binding    105865929 (GHRH) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Hormone_2 Motif Other DBs NCBI-GeneID:  105865929 NCBI-ProteinID:  XP_012610403 Ensembl:  ENSMICG00000044896 UniProt:  A0A8B7FNZ6 LinkDB All DBs Position 18:15238221..15246142 Genome browser AA seq 108 aa AA seqDB search MPLWVFLFVILTLSSGSHCSLPPSLPLRMRRYADAIFTNSYRKVLGQLSTRKLLQDIMSR QQGERNQEQGARVRLGRQVDGVWAEQKQMALESVLVALLQKHSRNFQG NT seq 327 nt NT seq  +upstreamnt  +downstreamnt atgccgctctgggtgttcctcttcgtgatcctcaccctcagcagcggctcccactgctcc ctgcccccctccctgcccctcaggatgcggcggtatgcagatgccatcttcaccaacagc taccgaaaggtgctgggccagctgtccacccgcaagctgctccaggacatcatgagcagg cagcagggagagagaaaccaggagcaaggagcaagggtacggcttggccgtcaggtagac ggtgtgtgggcagaacaaaagcaaatggcactggagagcgtcctggtggccctgctgcag aagcacagcaggaatttccaaggatga

DBGET integrated database retrieval system