Microcebus murinus (gray mouse lemur): 105865947 Help Entry 105865947         CDS       T07238                                  Symbol BCL2L1 Name (RefSeq) bcl-2-like protein 1   KO K04570   Bcl-2-like 1 (apoptosis regulator Bcl-X) Organism mmur  Microcebus murinus (gray mouse lemur) Pathway mmur01521   EGFR tyrosine kinase inhibitor resistance mmur01524   Platinum drug resistance mmur04014   Ras signaling pathway mmur04064   NF-kappa B signaling pathway mmur04115   p53 signaling pathway mmur04137   Mitophagy - animal mmur04140   Autophagy - animal mmur04151   PI3K-Akt signaling pathway mmur04210   Apoptosis mmur04215   Apoptosis - multiple species mmur04621   NOD-like receptor signaling pathway mmur04630   JAK-STAT signaling pathway mmur05012   Parkinson disease mmur05014   Amyotrophic lateral sclerosis mmur05022   Pathways of neurodegeneration - multiple diseases mmur05145   Toxoplasmosis mmur05162   Measles mmur05166   Human T-cell leukemia virus 1 infection mmur05168   Herpes simplex virus 1 infection mmur05170   Human immunodeficiency virus 1 infection mmur05200   Pathways in cancer mmur05202   Transcriptional misregulation in cancer mmur05212   Pancreatic cancer mmur05220   Chronic myeloid leukemia mmur05222   Small cell lung cancer mmur05225   Hepatocellular carcinoma mmur05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:mmur00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     105865947 (BCL2L1)    04630 JAK-STAT signaling pathway     105865947 (BCL2L1)    04064 NF-kappa B signaling pathway     105865947 (BCL2L1)    04151 PI3K-Akt signaling pathway     105865947 (BCL2L1)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     105865947 (BCL2L1)    04137 Mitophagy - animal     105865947 (BCL2L1)   09143 Cell growth and death    04210 Apoptosis     105865947 (BCL2L1)    04215 Apoptosis - multiple species     105865947 (BCL2L1)    04115 p53 signaling pathway     105865947 (BCL2L1)  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     105865947 (BCL2L1)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     105865947 (BCL2L1)    05202 Transcriptional misregulation in cancer     105865947 (BCL2L1)   09162 Cancer: specific types    05212 Pancreatic cancer     105865947 (BCL2L1)    05225 Hepatocellular carcinoma     105865947 (BCL2L1)    05220 Chronic myeloid leukemia     105865947 (BCL2L1)    05222 Small cell lung cancer     105865947 (BCL2L1)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     105865947 (BCL2L1)    05170 Human immunodeficiency virus 1 infection     105865947 (BCL2L1)    05162 Measles     105865947 (BCL2L1)    05168 Herpes simplex virus 1 infection     105865947 (BCL2L1)   09174 Infectious disease: parasitic    05145 Toxoplasmosis     105865947 (BCL2L1)   09164 Neurodegenerative disease    05012 Parkinson disease     105865947 (BCL2L1)    05014 Amyotrophic lateral sclerosis     105865947 (BCL2L1)    05022 Pathways of neurodegeneration - multiple diseases     105865947 (BCL2L1)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     105865947 (BCL2L1)   09176 Drug resistance: antineoplastic    01521 EGFR tyrosine kinase inhibitor resistance     105865947 (BCL2L1)    01524 Platinum drug resistance     105865947 (BCL2L1)  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:mmur01009]     105865947 (BCL2L1)   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:mmur03036]     105865947 (BCL2L1)   09183 Protein families: signaling and cellular processes    02000 Transporters [BR:mmur02000]     105865947 (BCL2L1) Protein phosphatases and associated proteins [BR:mmur01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Protein phosphatase-1     PP1-interacting proteins (PIPs)      105865947 (BCL2L1) Chromosome and associated proteins [BR:mmur03036]  Eukaryotic type   Centrosome formation proteins    Other centrosome associated proteins     105865947 (BCL2L1) Transporters [BR:mmur02000]  Other transporters   Pores ion channels [TC:1]    105865947 (BCL2L1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bcl-2 BH4 Bcl-2_3 Motif Other DBs NCBI-GeneID:  105865947 NCBI-ProteinID:  XP_012610450 Ensembl:  ENSMICG00000045727 UniProt:  A0A8B7FNN3 LinkDB All DBs Position 18:20173174..20223844 Genome browser AA seq 233 aa AA seqDB search MSQSNRELVVDFLSYKLSQKGYSWSQFIDAEENRTEAPEGTESEMETPSAINGNPSWHLA DSPPVNGATGHSSSLDAREVIPMAAVKQALKEAGDEFELRYRRAFSDLTSQLHITLATAY QSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLVSRIATWMATYLNDHLEP WIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK NT seq 702 nt NT seq  +upstreamnt  +downstreamnt atgtctcagagcaaccgggagctggtggttgactttctctcctacaagctttcccagaaa ggatacagctggagtcagtttattgatgcagaagaaaataggactgaggccccagaaggg actgaatcggagatggagacccccagtgccattaatggcaacccatcctggcacctggcg gacagccccccagtgaatggagccactggccacagcagcagtttggatgcccgggaggtg atccccatggcagcagtgaagcaagcactgaaggaggcaggcgatgagtttgaactgcgg taccggcgggcattcagtgacctgacatcccagctccacatcactctagcgacagcatat cagagctttgaacaggtagtgaatgaactcttccgggatggggtaaactggggtcgcatt gtggcctttttctccttcggcggggccctgtgcgtggaaagcgtggacaaggagatgcag gtattggtgagtcggatcgcaacttggatggccacttacctgaatgaccacctagagcct tggatccaggagaacggcggctgggacactttcgtggaactctacgggaacaatgcagca gctgagagccggaagggccaggaacgcttcaaccgctggttcctgacaggcatgactgtg gctggcgtggttctgctgggctcactcttcagtcggaaatga

DBGET integrated database retrieval system