Microcebus murinus (gray mouse lemur): 105866560 Help Entry 105866560         CDS       T07238                                  Name (RefSeq) metallothionein-1E   KO K14739   metallothionein 1/2 Organism mmur  Microcebus murinus (gray mouse lemur) Pathway mmur04978   Mineral absorption Brite KEGG Orthology (KO) [BR:mmur00001]  09150 Organismal Systems   09154 Digestive system    04978 Mineral absorption     105866560  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:mmur03019]     105866560    03029 Mitochondrial biogenesis [BR:mmur03029]     105866560 Messenger RNA biogenesis [BR:mmur03019]  Eukaryotic type   mRNA surveillance and transport factors    Factors involved in mRNA localization     Factors that have mRNA localization signals      105866560 Mitochondrial biogenesis [BR:mmur03029]  Mitochondrial quality control factors   Regulator of mitochondrial biogenesis    Nuclear respiratory factors     105866560 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Metallothio Motif Other DBs NCBI-GeneID:  105866560 NCBI-ProteinID:  XP_012611412 Ensembl:  ENSMICG00000042482 UniProt:  A0A8B7FS32 LinkDB All DBs Position 20:52995349..52996285 Genome browser AA seq 61 aa AA seqDB search MDPNCSCATGESCTCAGSCKCKECKCTSCKKSCCSCCPAGCAKCAQGCVCKGASNKCSCC A NT seq 186 nt NT seq  +upstreamnt  +downstreamnt atggatcccaactgctcttgcgccaccggcgaatcctgcacctgcgccggctcctgcaaa tgcaaagagtgcaaatgcacctcctgcaagaagagctgctgctcctgctgccccgcgggc tgcgccaagtgcgcccagggctgcgtctgcaaaggggcatcgaacaagtgcagctgctgc gcctga

DBGET integrated database retrieval system