Microcebus murinus (gray mouse lemur): 105869052 Help Entry 105869052         CDS       T07238                                  Symbol BRK1 Name (RefSeq) protein BRICK1   KO K05752   chromosome 3 open reading frame 10 Organism mmur  Microcebus murinus (gray mouse lemur) Pathway mmur04810   Regulation of actin cytoskeleton mmur05132   Salmonella infection Brite KEGG Orthology (KO) [BR:mmur00001]  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     105869052 (BRK1)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     105869052 (BRK1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CCDC53 Hydro_N_hd DUF7310 SPX Matrilin_ccoil MerR-DNA-bind DUF5617 LXG Motif Other DBs NCBI-GeneID:  105869052 NCBI-ProteinID:  XP_012616059 Ensembl:  ENSMICG00000045532 UniProt:  A0A8C5Y6Z0 LinkDB All DBs Position 26:8049903..8062258 Genome browser AA seq 75 aa AA seqDB search MAGQEDPVQREIHQDWANREYIEVITSSIKKIADFLNSFDMSCRSRLATLNEKLTALERR IEYIEARVTKGETLT NT seq 228 nt NT seq  +upstreamnt  +downstreamnt atggcgggccaagaggacccggtgcagcgggagattcaccaggactgggcgaaccgcgag tatatcgaggtcatcaccagcagcatcaagaagatcgcggactttctcaactcgttcgat atgtcttgtcgttcaagactcgcaaccctaaacgagaaattgacagcccttgaacggaga atagagtacatcgaagcacgggtgacaaaaggtgagacactcacctag

DBGET integrated database retrieval system