Microcebus murinus (gray mouse lemur): 105869365 Help Entry 105869365         CDS       T07238                                  Symbol CAV2 Name (RefSeq) caveolin-2   KO K12958   caveolin 2 Organism mmur  Microcebus murinus (gray mouse lemur) Pathway mmur04144   Endocytosis mmur04510   Focal adhesion mmur05020   Prion disease mmur05100   Bacterial invasion of epithelial cells mmur05205   Proteoglycans in cancer mmur05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:mmur00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     105869365 (CAV2)   09144 Cellular community - eukaryotes    04510 Focal adhesion     105869365 (CAV2)  09160 Human Diseases   09161 Cancer: overview    05205 Proteoglycans in cancer     105869365 (CAV2)   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     105869365 (CAV2)   09164 Neurodegenerative disease    05020 Prion disease     105869365 (CAV2)   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     105869365 (CAV2)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:mmur04131]     105869365 (CAV2) Membrane trafficking [BR:mmur04131]  Endocytosis   Lipid raft mediated endocytosis    Caveolin-mediated endocytosis     105869365 (CAV2) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Caveolin Motif Other DBs NCBI-GeneID:  105869365 NCBI-ProteinID:  XP_012616552 Ensembl:  ENSMICG00000045272 UniProt:  Q2QL91 LinkDB All DBs Position 11:complement(32834711..32842599) Genome browser AA seq 162 aa AA seqDB search MGLETEKADVQLFLDDDSYSHHGDVDFADPEKFADSDHDRDPHRLNSHLKVGFEDVIAEP MTTHSCDKVWICSHALFEISKYVMYKFLTVFLAIPLAFVAGILFATLSCLHIWIIMPFVK TCLMVLPSVQTIWKSVTDVIIAPLCTSVGRSFSSISLQLSHD NT seq 489 nt NT seq  +upstreamnt  +downstreamnt atggggctggagaccgagaaggcggacgtgcagctcttcctggacgacgactcctacagc caccacggcgacgtcgacttcgccgaccccgagaagttcgccgactcggaccatgaccgg gatccccaccggctcaactcgcacctcaaggtgggcttcgaggatgtgatcgcagagccc atgactacgcactcctgtgacaaagtgtggatctgtagccatgccctctttgaaatcagc aagtacgtgatgtacaagttcctgaccgtgttcctggccatccccctggccttcgttgcg ggaattctctttgccaccctcagctgcctgcacatctggattataatgccttttgtaaag acctgcctaatggttctgccttcagtgcagacaatatggaagagtgtgacagatgttatc attgccccattgtgtacaagcgtgggacgaagcttctcttctatcagcctgcaactgagc cacgactga

DBGET integrated database retrieval system