Microcebus murinus (gray mouse lemur): 105874278 Help Entry 105874278         CDS       T07238                                  Name (RefSeq) late histone H2B.L4-like   KO K11252   histone H2B Organism mmur  Microcebus murinus (gray mouse lemur) Pathway mmur04613   Neutrophil extracellular trap formation mmur05034   Alcoholism mmur05203   Viral carcinogenesis mmur05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:mmur00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     105874278  09160 Human Diseases   09161 Cancer: overview    05203 Viral carcinogenesis     105874278   09163 Immune disease    05322 Systemic lupus erythematosus     105874278   09165 Substance dependence    05034 Alcoholism     105874278  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:mmur03036]     105874278   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mmur04147]     105874278 Chromosome and associated proteins [BR:mmur03036]  Eukaryotic type   Nucleosome assembly factors    Histones     105874278 Exosome [BR:mmur04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    105874278 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone CBFD_NFYB_HMF TAF NFACT-R_2 TFIID_20kDa DUF7217 Motif Other DBs NCBI-GeneID:  105874278 NCBI-ProteinID:  XP_012625384 LinkDB All DBs Position X:complement(33767574..33772246) Genome browser AA seq 125 aa AA seqDB search MPQGSKESEEGESTTTTQKKKQPRRRARRSGRGADSFATYFPRVLKNVHDGLSLSQEAVS VMDSFVHDIFERIAEEAGRLARYTKRATITSREIQTAARLILPGEIGKHAVSEGTKAMAR YSRRR NT seq 378 nt NT seq  +upstreamnt  +downstreamnt atgccgcaaggatccaaggagtctgaagagggtgaatcgacgacgacgacccagaagaag aagcagccaaggcgtcgggcccgccgctccggccggggcgcggacagcttcgccacctac ttccccagggtcctgaagaacgtccacgacggcctcagcctgtcgcaggaggccgtgagc gtgatggactcgttcgtccacgacatcttcgagcgcatcgctgaggaggccggccggctg gcgcgctacaccaagcgcgcgaccatcacgtccagagagatccagacggccgcgcgcctc attctgcccggggaaatcggcaagcacgccgtgtccgagggcaccaaggccatggccaga tacagtcgccgcaggtga

DBGET integrated database retrieval system