Microcebus murinus (gray mouse lemur): 105878710 Help Entry 105878710         CDS       T07238                                  Symbol NRAS Name (RefSeq) GTPase NRas   KO K07828   GTPase NRas Organism mmur  Microcebus murinus (gray mouse lemur) Pathway mmur01521   EGFR tyrosine kinase inhibitor resistance mmur01522   Endocrine resistance mmur04010   MAPK signaling pathway mmur04012   ErbB signaling pathway mmur04014   Ras signaling pathway mmur04015   Rap1 signaling pathway mmur04062   Chemokine signaling pathway mmur04068   FoxO signaling pathway mmur04071   Sphingolipid signaling pathway mmur04072   Phospholipase D signaling pathway mmur04137   Mitophagy - animal mmur04140   Autophagy - animal mmur04150   mTOR signaling pathway mmur04151   PI3K-Akt signaling pathway mmur04210   Apoptosis mmur04211   Longevity regulating pathway mmur04213   Longevity regulating pathway - multiple species mmur04218   Cellular senescence mmur04360   Axon guidance mmur04370   VEGF signaling pathway mmur04371   Apelin signaling pathway mmur04540   Gap junction mmur04550   Signaling pathways regulating pluripotency of stem cells mmur04625   C-type lectin receptor signaling pathway mmur04650   Natural killer cell mediated cytotoxicity mmur04660   T cell receptor signaling pathway mmur04662   B cell receptor signaling pathway mmur04664   Fc epsilon RI signaling pathway mmur04714   Thermogenesis mmur04720   Long-term potentiation mmur04722   Neurotrophin signaling pathway mmur04725   Cholinergic synapse mmur04726   Serotonergic synapse mmur04730   Long-term depression mmur04810   Regulation of actin cytoskeleton mmur04910   Insulin signaling pathway mmur04912   GnRH signaling pathway mmur04915   Estrogen signaling pathway mmur04916   Melanogenesis mmur04917   Prolactin signaling pathway mmur04919   Thyroid hormone signaling pathway mmur04921   Oxytocin signaling pathway mmur04926   Relaxin signaling pathway mmur04929   GnRH secretion mmur04933   AGE-RAGE signaling pathway in diabetic complications mmur04935   Growth hormone synthesis, secretion and action mmur05010   Alzheimer disease mmur05022   Pathways of neurodegeneration - multiple diseases mmur05034   Alcoholism mmur05160   Hepatitis C mmur05161   Hepatitis B mmur05163   Human cytomegalovirus infection mmur05165   Human papillomavirus infection mmur05166   Human T-cell leukemia virus 1 infection mmur05167   Kaposi sarcoma-associated herpesvirus infection mmur05170   Human immunodeficiency virus 1 infection mmur05200   Pathways in cancer mmur05203   Viral carcinogenesis mmur05205   Proteoglycans in cancer mmur05206   MicroRNAs in cancer mmur05207   Chemical carcinogenesis - receptor activation mmur05208   Chemical carcinogenesis - reactive oxygen species mmur05210   Colorectal cancer mmur05211   Renal cell carcinoma mmur05213   Endometrial cancer mmur05214   Glioma mmur05215   Prostate cancer mmur05216   Thyroid cancer mmur05218   Melanoma mmur05219   Bladder cancer mmur05220   Chronic myeloid leukemia mmur05221   Acute myeloid leukemia mmur05223   Non-small cell lung cancer mmur05224   Breast cancer mmur05225   Hepatocellular carcinoma mmur05226   Gastric cancer mmur05230   Central carbon metabolism in cancer mmur05231   Choline metabolism in cancer mmur05235   PD-L1 expression and PD-1 checkpoint pathway in cancer mmur05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:mmur00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     105878710 (NRAS)    04012 ErbB signaling pathway     105878710 (NRAS)    04014 Ras signaling pathway     105878710 (NRAS)    04015 Rap1 signaling pathway     105878710 (NRAS)    04370 VEGF signaling pathway     105878710 (NRAS)    04371 Apelin signaling pathway     105878710 (NRAS)    04068 FoxO signaling pathway     105878710 (NRAS)    04072 Phospholipase D signaling pathway     105878710 (NRAS)    04071 Sphingolipid signaling pathway     105878710 (NRAS)    04151 PI3K-Akt signaling pathway     105878710 (NRAS)    04150 mTOR signaling pathway     105878710 (NRAS)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     105878710 (NRAS)    04137 Mitophagy - animal     105878710 (NRAS)   09143 Cell growth and death    04210 Apoptosis     105878710 (NRAS)    04218 Cellular senescence     105878710 (NRAS)   09144 Cellular community - eukaryotes    04540 Gap junction     105878710 (NRAS)    04550 Signaling pathways regulating pluripotency of stem cells     105878710 (NRAS)   09142 Cell motility    04810 Regulation of actin cytoskeleton     105878710 (NRAS)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     105878710 (NRAS)    04650 Natural killer cell mediated cytotoxicity     105878710 (NRAS)    04660 T cell receptor signaling pathway     105878710 (NRAS)    04662 B cell receptor signaling pathway     105878710 (NRAS)    04664 Fc epsilon RI signaling pathway     105878710 (NRAS)    04062 Chemokine signaling pathway     105878710 (NRAS)   09152 Endocrine system    04910 Insulin signaling pathway     105878710 (NRAS)    04929 GnRH secretion     105878710 (NRAS)    04912 GnRH signaling pathway     105878710 (NRAS)    04915 Estrogen signaling pathway     105878710 (NRAS)    04917 Prolactin signaling pathway     105878710 (NRAS)    04921 Oxytocin signaling pathway     105878710 (NRAS)    04926 Relaxin signaling pathway     105878710 (NRAS)    04935 Growth hormone synthesis, secretion and action     105878710 (NRAS)    04919 Thyroid hormone signaling pathway     105878710 (NRAS)    04916 Melanogenesis     105878710 (NRAS)   09156 Nervous system    04725 Cholinergic synapse     105878710 (NRAS)    04726 Serotonergic synapse     105878710 (NRAS)    04720 Long-term potentiation     105878710 (NRAS)    04730 Long-term depression     105878710 (NRAS)    04722 Neurotrophin signaling pathway     105878710 (NRAS)   09158 Development and regeneration    04360 Axon guidance     105878710 (NRAS)   09149 Aging    04211 Longevity regulating pathway     105878710 (NRAS)    04213 Longevity regulating pathway - multiple species     105878710 (NRAS)   09159 Environmental adaptation    04714 Thermogenesis     105878710 (NRAS)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     105878710 (NRAS)    05206 MicroRNAs in cancer     105878710 (NRAS)    05205 Proteoglycans in cancer     105878710 (NRAS)    05207 Chemical carcinogenesis - receptor activation     105878710 (NRAS)    05208 Chemical carcinogenesis - reactive oxygen species     105878710 (NRAS)    05203 Viral carcinogenesis     105878710 (NRAS)    05230 Central carbon metabolism in cancer     105878710 (NRAS)    05231 Choline metabolism in cancer     105878710 (NRAS)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     105878710 (NRAS)   09162 Cancer: specific types    05210 Colorectal cancer     105878710 (NRAS)    05225 Hepatocellular carcinoma     105878710 (NRAS)    05226 Gastric cancer     105878710 (NRAS)    05214 Glioma     105878710 (NRAS)    05216 Thyroid cancer     105878710 (NRAS)    05221 Acute myeloid leukemia     105878710 (NRAS)    05220 Chronic myeloid leukemia     105878710 (NRAS)    05218 Melanoma     105878710 (NRAS)    05211 Renal cell carcinoma     105878710 (NRAS)    05219 Bladder cancer     105878710 (NRAS)    05215 Prostate cancer     105878710 (NRAS)    05213 Endometrial cancer     105878710 (NRAS)    05224 Breast cancer     105878710 (NRAS)    05223 Non-small cell lung cancer     105878710 (NRAS)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     105878710 (NRAS)    05170 Human immunodeficiency virus 1 infection     105878710 (NRAS)    05161 Hepatitis B     105878710 (NRAS)    05160 Hepatitis C     105878710 (NRAS)    05163 Human cytomegalovirus infection     105878710 (NRAS)    05167 Kaposi sarcoma-associated herpesvirus infection     105878710 (NRAS)    05165 Human papillomavirus infection     105878710 (NRAS)   09164 Neurodegenerative disease    05010 Alzheimer disease     105878710 (NRAS)    05022 Pathways of neurodegeneration - multiple diseases     105878710 (NRAS)   09165 Substance dependence    05034 Alcoholism     105878710 (NRAS)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     105878710 (NRAS)   09167 Endocrine and metabolic disease    04933 AGE-RAGE signaling pathway in diabetic complications     105878710 (NRAS)   09176 Drug resistance: antineoplastic    01521 EGFR tyrosine kinase inhibitor resistance     105878710 (NRAS)    01522 Endocrine resistance     105878710 (NRAS)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:mmur04131]     105878710 (NRAS)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mmur04147]     105878710 (NRAS)    04031 GTP-binding proteins [BR:mmur04031]     105878710 (NRAS) Membrane trafficking [BR:mmur04131]  Exocytosis   Small GTPases and associated proteins    Other small GTPases and associated proteins     105878710 (NRAS)  Endocytosis   Macropinocytosis    Ras GTPases     105878710 (NRAS) Exosome [BR:mmur04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    105878710 (NRAS)   Exosomal proteins of other body fluids (saliva and urine)    105878710 (NRAS)   Exosomal proteins of breast cancer cells    105878710 (NRAS)   Exosomal proteins of colorectal cancer cells    105878710 (NRAS) GTP-binding proteins [BR:mmur04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     105878710 (NRAS) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc GTP_EFTU Arf RsgA_GTPase MMR_HSR1 FeoB_N AAA_14 Septin AAA_22 Ldh_1_N Motif Other DBs NCBI-GeneID:  105878710 NCBI-ProteinID:  XP_020137782 Ensembl:  ENSMICG00000043439 UniProt:  A0A8B7WR35 LinkDB All DBs Position 2:70620004..70630071 Genome browser AA seq 191 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEVRLRLPKQVVIDGETCLLDILDT AGQEEYSAMRDQYMRTGEGFLCVFAINNSKSFADINLYREQIKRVKDSDDVPMVLVGNKC DLPTRTVDTKQAHELAKSYGIPFIETSAKTRQGVEDAFYTLVREIRQYRMKKLNSSDDGT QGCMGLPCVVM NT seq 576 nt NT seq  +upstreamnt  +downstreamnt atgactgagtacaaactggtggtggttggagcaggtggtgttgggaaaagcgcactgaca atccagctaatccagaaccactttgtagatgaatatgatcccaccatagaggtgaggctc agattaccgaaacaggtggttatagatggtgaaacctgtctgttggacatactggataca gctggacaagaggagtacagtgccatgagagaccaatacatgaggacaggcgaaggcttc ctctgtgtatttgccatcaataatagcaagtcatttgcagatatcaacctctacagggag cagattaagcgagtaaaagattcagatgatgtacctatggtgctggtaggaaacaagtgt gatttgccaacaaggacagttgacacaaaacaagcccacgagctggccaagagttacggg attccatttattgaaacctcagccaagaccagacagggtgtcgaagatgccttttacaca ctggtaagagaaatacgccagtaccgaatgaaaaaactcaacagcagtgatgatgggact caaggttgtatggggttgccatgtgtggtgatgtaa

DBGET integrated database retrieval system