KEGG   Microcebus murinus (gray mouse lemur): 105878710
Entry
105878710         CDS       T07238                                 
Symbol
NRAS
Name
(RefSeq) GTPase NRas
  KO
K07828  GTPase NRas
Organism
mmur  Microcebus murinus (gray mouse lemur)
Pathway
mmur01521  EGFR tyrosine kinase inhibitor resistance
mmur01522  Endocrine resistance
mmur04010  MAPK signaling pathway
mmur04012  ErbB signaling pathway
mmur04014  Ras signaling pathway
mmur04015  Rap1 signaling pathway
mmur04062  Chemokine signaling pathway
mmur04068  FoxO signaling pathway
mmur04071  Sphingolipid signaling pathway
mmur04072  Phospholipase D signaling pathway
mmur04137  Mitophagy - animal
mmur04140  Autophagy - animal
mmur04150  mTOR signaling pathway
mmur04151  PI3K-Akt signaling pathway
mmur04210  Apoptosis
mmur04211  Longevity regulating pathway
mmur04213  Longevity regulating pathway - multiple species
mmur04218  Cellular senescence
mmur04360  Axon guidance
mmur04370  VEGF signaling pathway
mmur04371  Apelin signaling pathway
mmur04540  Gap junction
mmur04550  Signaling pathways regulating pluripotency of stem cells
mmur04625  C-type lectin receptor signaling pathway
mmur04650  Natural killer cell mediated cytotoxicity
mmur04660  T cell receptor signaling pathway
mmur04662  B cell receptor signaling pathway
mmur04664  Fc epsilon RI signaling pathway
mmur04714  Thermogenesis
mmur04720  Long-term potentiation
mmur04722  Neurotrophin signaling pathway
mmur04725  Cholinergic synapse
mmur04726  Serotonergic synapse
mmur04730  Long-term depression
mmur04810  Regulation of actin cytoskeleton
mmur04910  Insulin signaling pathway
mmur04912  GnRH signaling pathway
mmur04915  Estrogen signaling pathway
mmur04916  Melanogenesis
mmur04917  Prolactin signaling pathway
mmur04919  Thyroid hormone signaling pathway
mmur04921  Oxytocin signaling pathway
mmur04926  Relaxin signaling pathway
mmur04929  GnRH secretion
mmur04933  AGE-RAGE signaling pathway in diabetic complications
mmur04935  Growth hormone synthesis, secretion and action
mmur05010  Alzheimer disease
mmur05022  Pathways of neurodegeneration - multiple diseases
mmur05034  Alcoholism
mmur05160  Hepatitis C
mmur05161  Hepatitis B
mmur05163  Human cytomegalovirus infection
mmur05165  Human papillomavirus infection
mmur05166  Human T-cell leukemia virus 1 infection
mmur05167  Kaposi sarcoma-associated herpesvirus infection
mmur05170  Human immunodeficiency virus 1 infection
mmur05200  Pathways in cancer
mmur05203  Viral carcinogenesis
mmur05205  Proteoglycans in cancer
mmur05206  MicroRNAs in cancer
mmur05207  Chemical carcinogenesis - receptor activation
mmur05208  Chemical carcinogenesis - reactive oxygen species
mmur05210  Colorectal cancer
mmur05211  Renal cell carcinoma
mmur05213  Endometrial cancer
mmur05214  Glioma
mmur05215  Prostate cancer
mmur05216  Thyroid cancer
mmur05218  Melanoma
mmur05219  Bladder cancer
mmur05220  Chronic myeloid leukemia
mmur05221  Acute myeloid leukemia
mmur05223  Non-small cell lung cancer
mmur05224  Breast cancer
mmur05225  Hepatocellular carcinoma
mmur05226  Gastric cancer
mmur05230  Central carbon metabolism in cancer
mmur05231  Choline metabolism in cancer
mmur05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
mmur05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mmur00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    105878710 (NRAS)
   04012 ErbB signaling pathway
    105878710 (NRAS)
   04014 Ras signaling pathway
    105878710 (NRAS)
   04015 Rap1 signaling pathway
    105878710 (NRAS)
   04370 VEGF signaling pathway
    105878710 (NRAS)
   04371 Apelin signaling pathway
    105878710 (NRAS)
   04068 FoxO signaling pathway
    105878710 (NRAS)
   04072 Phospholipase D signaling pathway
    105878710 (NRAS)
   04071 Sphingolipid signaling pathway
    105878710 (NRAS)
   04151 PI3K-Akt signaling pathway
    105878710 (NRAS)
   04150 mTOR signaling pathway
    105878710 (NRAS)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    105878710 (NRAS)
   04137 Mitophagy - animal
    105878710 (NRAS)
  09143 Cell growth and death
   04210 Apoptosis
    105878710 (NRAS)
   04218 Cellular senescence
    105878710 (NRAS)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    105878710 (NRAS)
   04550 Signaling pathways regulating pluripotency of stem cells
    105878710 (NRAS)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    105878710 (NRAS)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    105878710 (NRAS)
   04650 Natural killer cell mediated cytotoxicity
    105878710 (NRAS)
   04660 T cell receptor signaling pathway
    105878710 (NRAS)
   04662 B cell receptor signaling pathway
    105878710 (NRAS)
   04664 Fc epsilon RI signaling pathway
    105878710 (NRAS)
   04062 Chemokine signaling pathway
    105878710 (NRAS)
  09152 Endocrine system
   04910 Insulin signaling pathway
    105878710 (NRAS)
   04929 GnRH secretion
    105878710 (NRAS)
   04912 GnRH signaling pathway
    105878710 (NRAS)
   04915 Estrogen signaling pathway
    105878710 (NRAS)
   04917 Prolactin signaling pathway
    105878710 (NRAS)
   04921 Oxytocin signaling pathway
    105878710 (NRAS)
   04926 Relaxin signaling pathway
    105878710 (NRAS)
   04935 Growth hormone synthesis, secretion and action
    105878710 (NRAS)
   04919 Thyroid hormone signaling pathway
    105878710 (NRAS)
   04916 Melanogenesis
    105878710 (NRAS)
  09156 Nervous system
   04725 Cholinergic synapse
    105878710 (NRAS)
   04726 Serotonergic synapse
    105878710 (NRAS)
   04720 Long-term potentiation
    105878710 (NRAS)
   04730 Long-term depression
    105878710 (NRAS)
   04722 Neurotrophin signaling pathway
    105878710 (NRAS)
  09158 Development and regeneration
   04360 Axon guidance
    105878710 (NRAS)
  09149 Aging
   04211 Longevity regulating pathway
    105878710 (NRAS)
   04213 Longevity regulating pathway - multiple species
    105878710 (NRAS)
  09159 Environmental adaptation
   04714 Thermogenesis
    105878710 (NRAS)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    105878710 (NRAS)
   05206 MicroRNAs in cancer
    105878710 (NRAS)
   05205 Proteoglycans in cancer
    105878710 (NRAS)
   05207 Chemical carcinogenesis - receptor activation
    105878710 (NRAS)
   05208 Chemical carcinogenesis - reactive oxygen species
    105878710 (NRAS)
   05203 Viral carcinogenesis
    105878710 (NRAS)
   05230 Central carbon metabolism in cancer
    105878710 (NRAS)
   05231 Choline metabolism in cancer
    105878710 (NRAS)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    105878710 (NRAS)
  09162 Cancer: specific types
   05210 Colorectal cancer
    105878710 (NRAS)
   05225 Hepatocellular carcinoma
    105878710 (NRAS)
   05226 Gastric cancer
    105878710 (NRAS)
   05214 Glioma
    105878710 (NRAS)
   05216 Thyroid cancer
    105878710 (NRAS)
   05221 Acute myeloid leukemia
    105878710 (NRAS)
   05220 Chronic myeloid leukemia
    105878710 (NRAS)
   05218 Melanoma
    105878710 (NRAS)
   05211 Renal cell carcinoma
    105878710 (NRAS)
   05219 Bladder cancer
    105878710 (NRAS)
   05215 Prostate cancer
    105878710 (NRAS)
   05213 Endometrial cancer
    105878710 (NRAS)
   05224 Breast cancer
    105878710 (NRAS)
   05223 Non-small cell lung cancer
    105878710 (NRAS)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    105878710 (NRAS)
   05170 Human immunodeficiency virus 1 infection
    105878710 (NRAS)
   05161 Hepatitis B
    105878710 (NRAS)
   05160 Hepatitis C
    105878710 (NRAS)
   05163 Human cytomegalovirus infection
    105878710 (NRAS)
   05167 Kaposi sarcoma-associated herpesvirus infection
    105878710 (NRAS)
   05165 Human papillomavirus infection
    105878710 (NRAS)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    105878710 (NRAS)
   05022 Pathways of neurodegeneration - multiple diseases
    105878710 (NRAS)
  09165 Substance dependence
   05034 Alcoholism
    105878710 (NRAS)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    105878710 (NRAS)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    105878710 (NRAS)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    105878710 (NRAS)
   01522 Endocrine resistance
    105878710 (NRAS)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmur04131]
    105878710 (NRAS)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmur04147]
    105878710 (NRAS)
   04031 GTP-binding proteins [BR:mmur04031]
    105878710 (NRAS)
Membrane trafficking [BR:mmur04131]
 Exocytosis
  Small GTPases and associated proteins
   Other small GTPases and associated proteins
    105878710 (NRAS)
 Endocytosis
  Macropinocytosis
   Ras GTPases
    105878710 (NRAS)
Exosome [BR:mmur04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   105878710 (NRAS)
  Exosomal proteins of other body fluids (saliva and urine)
   105878710 (NRAS)
  Exosomal proteins of breast cancer cells
   105878710 (NRAS)
  Exosomal proteins of colorectal cancer cells
   105878710 (NRAS)
GTP-binding proteins [BR:mmur04031]
 Small (monomeric) G-proteins
  Ras Family
   Ras [OT]
    105878710 (NRAS)
SSDB
Motif
Pfam: Ras Roc GTP_EFTU Arf RsgA_GTPase MMR_HSR1 FeoB_N AAA_22 Ldh_1_N Septin NB-ARC
Other DBs
NCBI-GeneID: 105878710
NCBI-ProteinID: XP_020137782
Ensembl: ENSMICG00000043439
UniProt: A0A8B7WR35
LinkDB
Position
2:70620004..70630071
AA seq 191 aa
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEVRLRLPKQVVIDGETCLLDILDT
AGQEEYSAMRDQYMRTGEGFLCVFAINNSKSFADINLYREQIKRVKDSDDVPMVLVGNKC
DLPTRTVDTKQAHELAKSYGIPFIETSAKTRQGVEDAFYTLVREIRQYRMKKLNSSDDGT
QGCMGLPCVVM
NT seq 576 nt   +upstreamnt  +downstreamnt
atgactgagtacaaactggtggtggttggagcaggtggtgttgggaaaagcgcactgaca
atccagctaatccagaaccactttgtagatgaatatgatcccaccatagaggtgaggctc
agattaccgaaacaggtggttatagatggtgaaacctgtctgttggacatactggataca
gctggacaagaggagtacagtgccatgagagaccaatacatgaggacaggcgaaggcttc
ctctgtgtatttgccatcaataatagcaagtcatttgcagatatcaacctctacagggag
cagattaagcgagtaaaagattcagatgatgtacctatggtgctggtaggaaacaagtgt
gatttgccaacaaggacagttgacacaaaacaagcccacgagctggccaagagttacggg
attccatttattgaaacctcagccaagaccagacagggtgtcgaagatgccttttacaca
ctggtaagagaaatacgccagtaccgaatgaaaaaactcaacagcagtgatgatgggact
caaggttgtatggggttgccatgtgtggtgatgtaa

DBGET integrated database retrieval system