Microcebus murinus (gray mouse lemur): 105878821 Help Entry 105878821         CDS       T07238                                  Name (RefSeq) histone H3.1   KO K11253   histone H3 Organism mmur  Microcebus murinus (gray mouse lemur) Pathway mmur04613   Neutrophil extracellular trap formation mmur05034   Alcoholism mmur05202   Transcriptional misregulation in cancer mmur05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:mmur00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     105878821  09160 Human Diseases   09161 Cancer: overview    05202 Transcriptional misregulation in cancer     105878821   09163 Immune disease    05322 Systemic lupus erythematosus     105878821   09165 Substance dependence    05034 Alcoholism     105878821  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:mmur03036]     105878821   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mmur04147]     105878821 Chromosome and associated proteins [BR:mmur03036]  Eukaryotic type   Nucleosome assembly factors    Histones     105878821 Exosome [BR:mmur04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    105878821 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone CENP-S CENP-T_C CBFD_NFYB_HMF PAF YebU_pre-PUA_dom TFIID-31kDa Motif Other DBs NCBI-GeneID:  105878821 NCBI-ProteinID:  XP_012634029 Ensembl:  ENSMICG00000045112 UniProt:  A0A8B7HB80 LinkDB All DBs Position 13:complement(84711546..84714001) Genome browser AA seq 136 aa AA seqDB search MARTKQTARKSTGGKAPRKQLATKVARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTI MPKDIQLARRIRGERA NT seq 411 nt NT seq  +upstreamnt  +downstreamnt atggctcgcaccaagcagacggcgcgcaagtcgacgggcggcaaggcaccgcgcaagcag ctggccaccaaggtggctcgcaagagtgccccggccacaggcggcgtgaagaagccgcac cgctaccggcccggcacggtggcgctgcgtgagatccgccgctaccagaagtccacggag ctgctgatccgcaagctgccgttccagcggctggtgcgagagatcgcgcaggacttcaag accgaccttcgcttccagagctcggctgtgatggcactgcaggaggcgtgcgaagcctac ctcgtggggctcttcgaggacaccaacctgtgcgccatccacgcgaagcgcgtcaccatc atgccgaaggacatccagctggcacgccgcattcgcggggagcgggcttag

DBGET integrated database retrieval system