Microcebus murinus (gray mouse lemur): 105879202 Help Entry 105879202         CDS       T07238                                  Symbol PSMB6 Name (RefSeq) proteasome subunit beta type-6   KO K02738   20S proteasome subunit beta 1 [EC:3.4.25.1] Organism mmur  Microcebus murinus (gray mouse lemur) Pathway mmur03050   Proteasome mmur05010   Alzheimer disease mmur05012   Parkinson disease mmur05014   Amyotrophic lateral sclerosis mmur05016   Huntington disease mmur05017   Spinocerebellar ataxia mmur05020   Prion disease mmur05022   Pathways of neurodegeneration - multiple diseases Brite KEGG Orthology (KO) [BR:mmur00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03050 Proteasome     105879202 (PSMB6)  09160 Human Diseases   09164 Neurodegenerative disease    05010 Alzheimer disease     105879202 (PSMB6)    05012 Parkinson disease     105879202 (PSMB6)    05014 Amyotrophic lateral sclerosis     105879202 (PSMB6)    05016 Huntington disease     105879202 (PSMB6)    05017 Spinocerebellar ataxia     105879202 (PSMB6)    05020 Prion disease     105879202 (PSMB6)    05022 Pathways of neurodegeneration - multiple diseases     105879202 (PSMB6)  09180 Brite Hierarchies   09181 Protein families: metabolism    01002 Peptidases and inhibitors [BR:mmur01002]     105879202 (PSMB6)   09182 Protein families: genetic information processing    03051 Proteasome [BR:mmur03051]     105879202 (PSMB6) Enzymes [BR:mmur01000]  3. Hydrolases   3.4  Acting on peptide bonds (peptidases)    3.4.25  Threonine endopeptidases     3.4.25.1  proteasome endopeptidase complex      105879202 (PSMB6) Peptidases and inhibitors [BR:mmur01002]  Threonine peptidases   Family T1: proteasome family    105879202 (PSMB6) Proteasome [BR:mmur03051]  Eukaryotic proteasome   Core particles (20S proteasome)    beta type subunits     105879202 (PSMB6) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Proteasome DUF1502 Motif Other DBs NCBI-GeneID:  105879202 NCBI-ProteinID:  XP_012634744 Ensembl:  ENSMICG00000014854 LinkDB All DBs Position 16:complement(52621944..52623548) Genome browser AA seq 156 aa AA seqDB search MAAALVAARGVGPAPAWGPEAITPDWENREVSTGTTIMAVQFDGGVVLGADSRTTTGSYI ANRVTDKLTPIHDRIFCCRSGSAADTQAVADAVTYQLGFHSIELNEPPLVHTAASLFKEM CYRYREDLMAGIIVAGWDPQEGGQVRPSSPPQPIPV NT seq 471 nt NT seq  +upstreamnt  +downstreamnt atggcggccgccttggtagcagctcggggagtagggccggcaccggcctgggggccggag gccatcactccagactgggaaaaccgtgaagtctcaacggggaccactatcatggccgtg caatttgacgggggcgtggtattgggggcggactccagaacaaccactgggtcatacatc gccaatcgagtgactgacaagctgactcctattcatgatcgaattttctgctgccgctca ggctcagcagctgatacccaagctgtagctgatgctgtcacttaccagcttggcttccac agcattgaactgaatgagcctccactggtgcacacagcagccagcctctttaaagagatg tgttaccgataccgggaagacctgatggcgggaattattgttgctggctgggatcctcaa gaaggagggcaggtcagaccctcttctcctccccaacccattcctgtgtga

DBGET integrated database retrieval system