Microcebus murinus (gray mouse lemur): 105880847 Help Entry 105880847         CDS       T07238                                  Name (RefSeq) ubiquitin isoform X1   KO K02927   ubiquitin-large subunit ribosomal protein L40e Organism mmur  Microcebus murinus (gray mouse lemur) Pathway mmur03010   Ribosome mmur04120   Ubiquitin mediated proteolysis mmur04137   Mitophagy - animal mmur04140   Autophagy - animal mmur05012   Parkinson disease mmur05022   Pathways of neurodegeneration - multiple diseases mmur05167   Kaposi sarcoma-associated herpesvirus infection mmur05171   Coronavirus disease - COVID-19 Brite KEGG Orthology (KO) [BR:mmur00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     105880847   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     105880847  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     105880847    04137 Mitophagy - animal     105880847  09160 Human Diseases   09172 Infectious disease: viral    05171 Coronavirus disease - COVID-19     105880847    05167 Kaposi sarcoma-associated herpesvirus infection     105880847   09164 Neurodegenerative disease    05012 Parkinson disease     105880847    05022 Pathways of neurodegeneration - multiple diseases     105880847  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:mmur03011]     105880847    04121 Ubiquitin system [BR:mmur04121]     105880847 Ribosome [BR:mmur03011]  Ribosomal proteins   Eukaryotes    Large subunit     105880847   Archaea     105880847 Ubiquitin system [BR:mmur04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    105880847 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ubiquitin Rad60-SLD Ubiquitin_2 DUF2604 Rad60-SLD_2 TBK1_ULD Ubiquitin_5 Plexin_RBD UBL_UBAC1 OTU1_UBXL Dsc3_N Motif Other DBs NCBI-GeneID:  105880847 NCBI-ProteinID:  XP_020138557 Ensembl:  ENSMICG00000045073 LinkDB All DBs Position 21:21635261..21636650 Genome browser AA seq 91 aa AA seqDB search MTPGTNFLYRDRKTMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFA GKQLEDGRTLSDYNIQKESTLHLVLRLRGGV NT seq 276 nt NT seq  +upstreamnt  +downstreamnt atgactccgggcactaattttctttacagagaccggaagacaatgcagatctttgtgaag accctgaccggcaagaccatcaccctcgaggtggagcccagcgacaccattgagaatgtc aaggcaaagatccaagacaaggaaggcatccctcctgatcagcagaggctgatctttgcc gggaagcagctggaagatggacgcaccctctctgactacaacatccagaaagagtccacc ctgcacttggtcctgcgcttgaggggaggtgtctaa

DBGET integrated database retrieval system