Microcebus murinus (gray mouse lemur): 105881575 Help Entry 105881575         CDS       T07238                                  Symbol RAB5A Name (RefSeq) ras-related protein Rab-5A   KO K07887   Ras-related protein Rab-5A Organism mmur  Microcebus murinus (gray mouse lemur) Pathway mmur04014   Ras signaling pathway mmur04137   Mitophagy - animal mmur04144   Endocytosis mmur04145   Phagosome mmur04148   Efferocytosis mmur04962   Vasopressin-regulated water reabsorption mmur05014   Amyotrophic lateral sclerosis mmur05022   Pathways of neurodegeneration - multiple diseases mmur05132   Salmonella infection mmur05146   Amoebiasis mmur05152   Tuberculosis Brite KEGG Orthology (KO) [BR:mmur00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     105881575 (RAB5A)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     105881575 (RAB5A)    04145 Phagosome     105881575 (RAB5A)    04137 Mitophagy - animal     105881575 (RAB5A)    04148 Efferocytosis     105881575 (RAB5A)  09150 Organismal Systems   09155 Excretory system    04962 Vasopressin-regulated water reabsorption     105881575 (RAB5A)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     105881575 (RAB5A)    05152 Tuberculosis     105881575 (RAB5A)   09174 Infectious disease: parasitic    05146 Amoebiasis     105881575 (RAB5A)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     105881575 (RAB5A)    05022 Pathways of neurodegeneration - multiple diseases     105881575 (RAB5A)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:mmur04131]     105881575 (RAB5A)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mmur04147]     105881575 (RAB5A)    04031 GTP-binding proteins [BR:mmur04031]     105881575 (RAB5A) Membrane trafficking [BR:mmur04131]  Endocytosis   Rab GTPases and associated proteins    Rab GTPases     105881575 (RAB5A)  Endosome - Lysosome transport     105881575 (RAB5A) Exosome [BR:mmur04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    105881575 (RAB5A)   Exosomal proteins of other body fluids (saliva and urine)    105881575 (RAB5A)   Exosomal proteins of colorectal cancer cells    105881575 (RAB5A)   Exosomal proteins of bladder cancer cells    105881575 (RAB5A) GTP-binding proteins [BR:mmur04031]  Small (monomeric) G-proteins   Rab Family    Rab5/17/22/31 [OT]     105881575 (RAB5A) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Gtr1_RagA MMR_HSR1 RsgA_GTPase AAA_16 MCR_beta BrnT_toxin Motif Other DBs NCBI-GeneID:  105881575 NCBI-ProteinID:  XP_012638734 Ensembl:  ENSMICG00000049130 UniProt:  A0A8B7HM82 LinkDB All DBs Position 1:12709310..12753539 Genome browser AA seq 215 aa AA seqDB search MANRGATRPNGPNTGNKICQFKLVLLGESAVGKSSLVLRFVKGQFHEFQESTIGAAFLTQ TVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNEESFARAKNWVKELQR QASPNIVIALSGNKADLANKRAVDFQEAQSYADDNSLLFMETSAKTSMNVNEIFMAIAKK LPKNEPQNPGANSARGRGVDLTEPTQPTRSQCCSN NT seq 648 nt NT seq  +upstreamnt  +downstreamnt atggccaatcgaggtgcaacaagacccaacgggccaaatactggaaataaaatatgccag ttcaaactagtacttctgggagaatctgctgttggtaaatcaagcctagtgcttcgtttt gtgaaaggccaatttcatgaatttcaagaaagtaccattggggctgcttttctaacccaa actgtgtgtcttgatgacactacagtaaaatttgaaatatgggatacagctggtcaagaa cgataccatagcctagcaccaatgtactacagaggagcacaagcagccatagttgtatat gatatcacaaatgaggagtcctttgcaagagcaaaaaattgggttaaagaacttcagagg caagcaagtcctaacattgtaatagctttatcaggaaacaaggctgacctagcaaataaa agagctgtagatttccaggaagcacagtcctatgcagatgataacagtttattattcatg gagacatccgccaaaacatcaatgaatgtgaacgaaatattcatggcaatagctaaaaag ttgccaaagaatgaaccacagaatccaggagcaaattctgccagaggaagaggagtagac cttactgaacctacacaaccaaccaggagtcagtgttgtagtaactaa

DBGET integrated database retrieval system