Microcebus murinus (gray mouse lemur): 105881608 Help Entry 105881608         CDS       T07238                                  Name (RefSeq) C-C motif chemokine 3-like   KO K05408   C-C motif chemokine 3 Organism mmur  Microcebus murinus (gray mouse lemur) Pathway mmur04060   Cytokine-cytokine receptor interaction mmur04061   Viral protein interaction with cytokine and cytokine receptor mmur04062   Chemokine signaling pathway mmur04620   Toll-like receptor signaling pathway mmur05142   Chagas disease mmur05163   Human cytomegalovirus infection mmur05323   Rheumatoid arthritis mmur05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:mmur00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     105881608    04061 Viral protein interaction with cytokine and cytokine receptor     105881608  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     105881608    04062 Chemokine signaling pathway     105881608  09160 Human Diseases   09172 Infectious disease: viral    05163 Human cytomegalovirus infection     105881608   09174 Infectious disease: parasitic    05142 Chagas disease     105881608   09163 Immune disease    05323 Rheumatoid arthritis     105881608   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     105881608  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:mmur04052]     105881608    00536 Glycosaminoglycan binding proteins [BR:mmur00536]     105881608 Cytokines and neuropeptides [BR:mmur04052]  Cytokines   Chemokines    105881608 Glycosaminoglycan binding proteins [BR:mmur00536]  Heparan sulfate / Heparin   Chemokines    105881608 SSDB OrthologParalogGFIT Motif Pfam:  IL8 Motif Other DBs NCBI-GeneID:  105881608 NCBI-ProteinID:  XP_012638783 Ensembl:  ENSMICG00000041554 UniProt:  A0A8B7HMC3 LinkDB All DBs Position 16:complement(13596248..13598901) Genome browser AA seq 120 aa AA seqDB search MKVSMAAAAVLLCTMALFNQVFSAPFGADTPTACCFSYASRQIQRKFIVDYFETNSQCAK PGVIFITRRGRKICADPSEAWVQDYVTDLEMNVQATSVGPVGSRGPSLGTIPVTSTATSW NT seq 363 nt NT seq  +upstreamnt  +downstreamnt atgaaggtctccatggctgctgctgccgtcctcctctgcaccatggccctcttcaaccag gtcttctctgcaccatttggtgctgacaccccgactgcctgttgcttctcctacgcctcc cggcagattcaacgcaaattcatagttgactattttgagaccaacagccagtgcgccaag ccaggtgtcatcttcataaccaggagaggccgaaagatctgtgccgaccccagtgaggcc tgggtccaggactatgtcacggacctggagatgaatgtccaagcgacctcggtgggccca gtggggagcaggggcccgagcctcggaaccatccctgtgacttccacagctacctcatgg tag

DBGET integrated database retrieval system