Microcebus murinus (gray mouse lemur): 105881899 Help Entry 105881899         CDS       T07238                                  Name (RefSeq) C-C motif chemokine 3-like   KO K05408   C-C motif chemokine 3 Organism mmur  Microcebus murinus (gray mouse lemur) Pathway mmur04060   Cytokine-cytokine receptor interaction mmur04061   Viral protein interaction with cytokine and cytokine receptor mmur04062   Chemokine signaling pathway mmur04620   Toll-like receptor signaling pathway mmur05142   Chagas disease mmur05163   Human cytomegalovirus infection mmur05323   Rheumatoid arthritis mmur05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:mmur00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     105881899    04061 Viral protein interaction with cytokine and cytokine receptor     105881899  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     105881899    04062 Chemokine signaling pathway     105881899  09160 Human Diseases   09172 Infectious disease: viral    05163 Human cytomegalovirus infection     105881899   09174 Infectious disease: parasitic    05142 Chagas disease     105881899   09163 Immune disease    05323 Rheumatoid arthritis     105881899   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     105881899  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:mmur04052]     105881899    00536 Glycosaminoglycan binding proteins [BR:mmur00536]     105881899 Cytokines and neuropeptides [BR:mmur04052]  Cytokines   Chemokines    105881899 Glycosaminoglycan binding proteins [BR:mmur00536]  Heparan sulfate / Heparin   Chemokines    105881899 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL8 CXCL16 DUF4131 Motif Other DBs NCBI-GeneID:  105881899 NCBI-ProteinID:  XP_012639779 LinkDB All DBs Position 16:13438824..13576402 Genome browser AA seq 93 aa AA seqDB search MRVPAAALAALFFTEALRPQPCSASFGAGTPTACCFSYISWQLPLRSVDDYSETSSQCSR PAVIFLTKRGRQVCADPGEAWVQEYVTNLELNA NT seq 282 nt NT seq  +upstreamnt  +downstreamnt atgcgggtgcccgcggccgcccttgccgccctgttcttcacggaggccctgcgcccccag ccctgctctgcctcgtttggagccggcaccccgaccgcctgctgcttctcctatatctcc tggcagcttccactccgatccgtggacgactactctgagaccagcagccagtgctccagg ccagctgtcatcttcctcaccaagagaggccggcaggtgtgtgccgaccccggtgaggcc tgggtccaggaatacgtcaccaacctggagctgaatgcctga

DBGET integrated database retrieval system