Microcebus murinus (gray mouse lemur): 105882697 Help Entry 105882697         CDS       T07238                                  Symbol NPPB Name (RefSeq) natriuretic peptides B   KO K12335   natriuretic peptide B Organism mmur  Microcebus murinus (gray mouse lemur) Pathway mmur04022   cGMP-PKG signaling pathway mmur04081   Hormone signaling mmur04270   Vascular smooth muscle contraction mmur04714   Thermogenesis Brite KEGG Orthology (KO) [BR:mmur00001]  09130 Environmental Information Processing   09132 Signal transduction    04022 cGMP-PKG signaling pathway     105882697 (NPPB)   09133 Signaling molecules and interaction    04081 Hormone signaling     105882697 (NPPB)  09150 Organismal Systems   09153 Circulatory system    04270 Vascular smooth muscle contraction     105882697 (NPPB)   09159 Environmental adaptation    04714 Thermogenesis     105882697 (NPPB)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:mmur04052]     105882697 (NPPB) Cytokines and neuropeptides [BR:mmur04052]  Neuropeptides   Unclassified    105882697 (NPPB) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ANP DUF2868 Motif Other DBs NCBI-GeneID:  105882697 NCBI-ProteinID:  XP_012640769 Ensembl:  ENSMICG00000032500 UniProt:  A0A8B7HU57 LinkDB All DBs Position 2:60639223..60640994 Genome browser AA seq 132 aa AA seqDB search MNPPTALPRALLLLLFLHLSLLGGRSHPLGHPSPASELSGMQELLDRLRDKVSELQAKQM ALEPLQQIQGPTEAWGSQEAAPEDVLGPRKNALQFPRSLQGPKMMRDSGCFGRRLDRIGS HSSLGCNVLRRY NT seq 399 nt NT seq  +upstreamnt  +downstreamnt atgaatcccccgacggcactgccccgggcactcctgctcctccttttcttgcacctatcg ctgctgggaggtcgttctcacccgctgggccaccccagtccagcctcggaactgtctggg atgcaggagctgctggatcgtctgcgggacaaagtctccgagctgcaggcaaagcagatg gccctggagcccctccagcagatccagggccccacagaagcctgggggtcccaagaggca gcccccgaggacgtcctggggccccgcaaaaacgccctccagttcccgcggagcctgcag ggccccaagatgatgcgcgactcaggctgcttcgggcggaggctggaccggatcggctcc cacagcagcctgggctgcaacgtgctcaggagatattaa

DBGET integrated database retrieval system