Microcebus murinus (gray mouse lemur): 105882988 Help Entry 105882988         CDS       T07238                                  Symbol RAB7A Name (RefSeq) ras-related protein Rab-7a   KO K07897   Ras-related protein Rab-7A Organism mmur  Microcebus murinus (gray mouse lemur) Pathway mmur04137   Mitophagy - animal mmur04140   Autophagy - animal mmur04144   Endocytosis mmur04145   Phagosome mmur04148   Efferocytosis mmur05132   Salmonella infection mmur05146   Amoebiasis mmur05152   Tuberculosis Brite KEGG Orthology (KO) [BR:mmur00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     105882988 (RAB7A)    04145 Phagosome     105882988 (RAB7A)    04140 Autophagy - animal     105882988 (RAB7A)    04137 Mitophagy - animal     105882988 (RAB7A)    04148 Efferocytosis     105882988 (RAB7A)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     105882988 (RAB7A)    05152 Tuberculosis     105882988 (RAB7A)   09174 Infectious disease: parasitic    05146 Amoebiasis     105882988 (RAB7A)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:mmur04131]     105882988 (RAB7A)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mmur04147]     105882988 (RAB7A)    04031 GTP-binding proteins [BR:mmur04031]     105882988 (RAB7A) Membrane trafficking [BR:mmur04131]  Endosome - Lysosome transport   Rab GTPases and associated proteins    Rab GTPases     105882988 (RAB7A) Exosome [BR:mmur04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    105882988 (RAB7A)   Exosomal proteins of other body fluids (saliva and urine)    105882988 (RAB7A)   Exosomal proteins of colorectal cancer cells    105882988 (RAB7A)   Exosomal proteins of bladder cancer cells    105882988 (RAB7A) GTP-binding proteins [BR:mmur04031]  Small (monomeric) G-proteins   Rab Family    Rab7/9 [OT]     105882988 (RAB7A) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf MMR_HSR1 GTP_EFTU RsgA_GTPase Gtr1_RagA ATP_bind_1 cobW nSTAND3 PduV-EutP Septin AAA_16 AAA_7 AAA_24 AAA_22 NTPase_1 AAA_5 AAA_14 G-alpha ATPase_2 NACHT NB-ARC SRPRB ATP-synt_ab Motif Other DBs NCBI-GeneID:  105882988 NCBI-ProteinID:  XP_020138788 Ensembl:  ENSMICG00000038752 LinkDB All DBs Position 22:complement(1388974..1413306) Genome browser AA seq 207 aa AA seqDB search MTSRKKVLLKVIILGDSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVMVDDRLVTMQ IWDTAGQERFQSLGVAFYRGADCCVLVFDVTAPNTFKTLDSWRDEFLIQASPRDPENFPF VVLGNKIDLESRQVATKRAQAWCYSKNNIPYFETSAKEAINVEQAFQTIATDSLPQETEV ELYNEFPEPIKLDKNDRAKASAESCSC NT seq 624 nt NT seq  +upstreamnt  +downstreamnt atgacgtctaggaagaaggtcctgctgaaggtcatcatcctgggagactcgggggtcggt aagacgtctctcatgaaccagtatgtcaacaagaagttcagcaaccagtacaaagccaca ataggagcagacttcctcaccaaggaggtcatggtggacgacaggctagtgaccatgcag atctgggacacggcggggcaggagcggttccagtctctgggcgtggcgttctaccgcggc gccgactgctgcgtgctggtcttcgacgtcacggcgcccaacaccttcaagacgctggac agctggcgcgacgagttcctcatccaggccagcccgcgcgaccccgagaacttccccttc gtcgtcctgggcaacaagatcgacctcgagagcagacaggtggccacgaagcgggcccag gcctggtgctacagcaaaaacaacatcccgtacttcgagaccagcgccaaggaggccatc aacgtggagcaggccttccagaccatcgccacggattccctgccccaggagacggaggtg gagctgtacaacgagttccccgagcccatcaaactggacaagaacgaccgggccaaggcg tcggccgagagctgcagctgctga

DBGET integrated database retrieval system