Microcebus murinus (gray mouse lemur): 105883796 Help Entry 105883796         CDS       T07238                                  Name (RefSeq) ras-related protein Rab-7a-like   KO K07897   Ras-related protein Rab-7A Organism mmur  Microcebus murinus (gray mouse lemur) Pathway mmur04137   Mitophagy - animal mmur04140   Autophagy - animal mmur04144   Endocytosis mmur04145   Phagosome mmur04148   Efferocytosis mmur05132   Salmonella infection mmur05146   Amoebiasis mmur05152   Tuberculosis Brite KEGG Orthology (KO) [BR:mmur00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     105883796    04145 Phagosome     105883796    04140 Autophagy - animal     105883796    04137 Mitophagy - animal     105883796    04148 Efferocytosis     105883796  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     105883796    05152 Tuberculosis     105883796   09174 Infectious disease: parasitic    05146 Amoebiasis     105883796  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:mmur04131]     105883796   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mmur04147]     105883796    04031 GTP-binding proteins [BR:mmur04031]     105883796 Membrane trafficking [BR:mmur04131]  Endosome - Lysosome transport   Rab GTPases and associated proteins    Rab GTPases     105883796 Exosome [BR:mmur04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    105883796   Exosomal proteins of other body fluids (saliva and urine)    105883796   Exosomal proteins of colorectal cancer cells    105883796   Exosomal proteins of bladder cancer cells    105883796 GTP-binding proteins [BR:mmur04031]  Small (monomeric) G-proteins   Rab Family    Rab7/9 [OT]     105883796 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc RsgA_GTPase nSTAND3 MMR_HSR1 AAA_22 Septin AAA_7 cobW AAA_24 AAA_16 PduV-EutP AAA_5 Arf ATPase_2 NACHT MCM ATP-synt_ab NB-ARC AAA_14 DAP3 NTPase_1 RNA_helicase ABC_tran RuvB_N G-alpha AAA_29 nSTAND1 Sigma54_activat TniB SRPRB Motif Other DBs NCBI-GeneID:  105883796 NCBI-ProteinID:  XP_012642700 Ensembl:  ENSMICG00000046001 UniProt:  A0A8B7HZK7 LinkDB All DBs Position 22:1321288..1326772 Genome browser AA seq 74 aa AA seqDB search MTSRKKVLLKVIILGDSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVMVDDRLVTMQ VSGPRGRASTFCSL NT seq 225 nt NT seq  +upstreamnt  +downstreamnt atgacgtctaggaagaaggtcctgctgaaggtcatcatcctgggagactcgggggtcggt aagacgtctctcatgaaccagtatgtcaacaagaagttcagcaaccagtacaaagccaca ataggagcagacttcctcaccaaggaggtcatggtggacgacaggctagtgaccatgcag gtaagcgggcctcgcggccgggcctccaccttttgctcgctgtga

DBGET integrated database retrieval system