Microcebus murinus (gray mouse lemur): 105883834 Help Entry 105883834         CDS       T07238                                  Symbol PFN3 Name (RefSeq) profilin-3   KO K05759   profilin Organism mmur  Microcebus murinus (gray mouse lemur) Pathway mmur04015   Rap1 signaling pathway mmur04810   Regulation of actin cytoskeleton mmur05014   Amyotrophic lateral sclerosis mmur05132   Salmonella infection Brite KEGG Orthology (KO) [BR:mmur00001]  09130 Environmental Information Processing   09132 Signal transduction    04015 Rap1 signaling pathway     105883834 (PFN3)  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     105883834 (PFN3)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     105883834 (PFN3)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     105883834 (PFN3)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:mmur04131]     105883834 (PFN3)   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:mmur04812]     105883834 (PFN3)    04147 Exosome [BR:mmur04147]     105883834 (PFN3) Membrane trafficking [BR:mmur04131]  Others   Actin-binding proteins    Others     105883834 (PFN3) Cytoskeleton proteins [BR:mmur04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Profilin      105883834 (PFN3) Exosome [BR:mmur04147]  Exosomal proteins   Proteins found in most exosomes    105883834 (PFN3) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Profilin Motif Other DBs NCBI-GeneID:  105883834 NCBI-ProteinID:  XP_012642742 LinkDB All DBs Position 32:complement(817421..818193) Genome browser AA seq 137 aa AA seqDB search MGDWKGYISAVLRDQRIDDVAIVGHADNRCVWASRPGGLLAAISPQEVGVLTGPDRRTFL QAGLSVAGRRCCVIRDHLLAEGDGVLDARTKGLDGRAVCVGHSPRALLVLMGRRGVHGGV LNKTVHELIRGLRTQGA NT seq 414 nt NT seq  +upstreamnt  +downstreamnt atgggcgactggaaaggctacatcagcgcggtgctgcgggaccagcgaatcgacgacgtg gccatcgtgggccacgcggacaaccgctgcgtgtgggcgtcgcggcccggcgggctgctg gcggccatctcgccgcaggaggtgggcgtgctcaccgggccggaccggcgcaccttcctg caggccggcctgagcgtggcgggccgccgctgctgcgtcatccgcgaccacctgctggcc gagggcgacggcgtgctggacgcgcgcaccaaggggctggacgggcgcgccgtctgcgtg ggccactcgccgcgcgcgctgctcgtgctcatgggccggcgcggcgtgcacggcggcgtg ctcaacaagacggtgcacgagctgatccgcgggctgcgcacgcagggcgcctag

DBGET integrated database retrieval system