Microcebus murinus (gray mouse lemur): 105884174 Help Entry 105884174         CDS       T07238                                  Name (RefSeq) late histone H2B.L4-like   KO K11252   histone H2B Organism mmur  Microcebus murinus (gray mouse lemur) Pathway mmur04613   Neutrophil extracellular trap formation mmur05034   Alcoholism mmur05203   Viral carcinogenesis mmur05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:mmur00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     105884174  09160 Human Diseases   09161 Cancer: overview    05203 Viral carcinogenesis     105884174   09163 Immune disease    05322 Systemic lupus erythematosus     105884174   09165 Substance dependence    05034 Alcoholism     105884174  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:mmur03036]     105884174   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mmur04147]     105884174 Chromosome and associated proteins [BR:mmur03036]  Eukaryotic type   Nucleosome assembly factors    Histones     105884174 Exosome [BR:mmur04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    105884174 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone CBFD_NFYB_HMF TAF TFIID_20kDa NFACT-R_2 DUF7217 Motif Other DBs NCBI-GeneID:  105884174 NCBI-ProteinID:  XP_012643345 LinkDB All DBs Position X:32753205..32753668 Genome browser AA seq 146 aa AA seqDB search MAVLAMAEPVSEMSSEACSFSKEPKEAESMRTLKKQPRHRGHHSRWGEDSFATYFPRVLK NVHDGLSLSQEAVSVMDSFVHDIFERIAEEAGRLARYTKRATITSREIQTAARLILPGEI GKHAVSEGTKAMARYSRRRVSASGSR NT seq 441 nt NT seq  +upstreamnt  +downstreamnt atggctgtcttggccatggccgagcctgtgtctgagatgtcctctgaggcctgctctttc tccaaggagcctaaggaagctgaatcgatgaggaccctgaagaagcagccaaggcatcgc ggccaccactccaggtggggcgaggacagcttcgccacctacttccccagagtcctgaag aacgtccacgacggcctcagcctgtcccaggaggccgtgagcgtgatggattcgttcgtc cacgacatcttcgagcgcatcgctgaggaggccggccggctggcgcgctacaccaagcgc gcgaccatcacgtccagagagatccagacggccgcgcgcctcattctgcccggggaaatc ggcaagcacgccgtgtccgagggcaccaaggccatggccagatacagtcgccgcagggta agcgcctcaggatcgcgctga

DBGET integrated database retrieval system