Microcebus murinus (gray mouse lemur): 109729267 Help Entry 109729267         CDS       T07238                                  Name (RefSeq) histone H2B type 2-E-like   KO K11252   histone H2B Organism mmur  Microcebus murinus (gray mouse lemur) Pathway mmur04613   Neutrophil extracellular trap formation mmur05034   Alcoholism mmur05203   Viral carcinogenesis mmur05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:mmur00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     109729267  09160 Human Diseases   09161 Cancer: overview    05203 Viral carcinogenesis     109729267   09163 Immune disease    05322 Systemic lupus erythematosus     109729267   09165 Substance dependence    05034 Alcoholism     109729267  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:mmur03036]     109729267   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mmur04147]     109729267 Chromosome and associated proteins [BR:mmur03036]  Eukaryotic type   Nucleosome assembly factors    Histones     109729267 Exosome [BR:mmur04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    109729267 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone CBFD_NFYB_HMF TFIID_20kDa YscO-like LonB_AAA-LID Motif Other DBs NCBI-GeneID:  109729267 NCBI-ProteinID:  XP_020135876 LinkDB All DBs Position 14:complement(22470252..22470944) Genome browser AA seq 136 aa AA seqDB search MPEPAKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSIYVYKVLKQVHPDTGISSKAM GIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHARFNEIQEVL HIFNQFNNKSNSRNCY NT seq 411 nt NT seq  +upstreamnt  +downstreamnt atgcctgagccagcgaaatccgcccctgcgcctaagaagggctctaagaaggctgtgact aaagcccagaaaaaagatggcaaaaagcgtaagcgcagtcgcaaggagagctactccatc tatgtttacaaagtgctgaaacaggttcatccggacaccggcatctcctcgaaggccatg ggcatcatgaactcgttcgtcaacgacatcttcgagcgcatcgcgggcgaggcctctcgc ctggcgcattacaacaagcgctcgaccatcacctccagggagatccagacggcggtgcgc ctgctgctgccgggagagctggccaagcacgcaagatttaacgagatccaagaagttctg catatttttaaccaatttaacaacaaatcaaattctcgtaactgctattag

DBGET integrated database retrieval system