Microcebus murinus (gray mouse lemur): 109730349 Help Entry 109730349         CDS       T07238                                  Name (RefSeq) protein S100-A10-like   KO K17274   protein S100-A10 Organism mmur  Microcebus murinus (gray mouse lemur) Pathway mmur04382   Cornified envelope formation mmur05132   Salmonella infection Brite KEGG Orthology (KO) [BR:mmur00001]  09150 Organismal Systems   09158 Development and regeneration    04382 Cornified envelope formation     109730349  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     109730349  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mmur04147]     109730349 Exosome [BR:mmur04147]  Exosomal proteins   Exosomal proteins of microglial cells    109730349 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  S_100 EF-hand_7 EF-hand_1 EFhand_Ca_insen EF-hand_6 Motif Other DBs NCBI-GeneID:  109730349 NCBI-ProteinID:  XP_020140979 LinkDB All DBs Position Unknown AA seq 74 aa AA seqDB search MPSQMEHAMETMMFTFHKFAGDKGYLTKDDLRVLMEKEFPGFLENQKDPLALDKIMKDLD QCRDGKVGFQSFFS NT seq 222 nt NT seq  +upstreamnt  +downstreamnt atgccatctcaaatggaacatgccatggaaaccatgatgtttacatttcacaaatttgcc ggggataaaggctacttaacaaaggatgacctgagagtactcatggaaaaggagttccct ggatttttggaaaatcagaaagaccctctggccttggacaaaataatgaaggacctggac cagtgccgggacggcaaagtgggcttccagagcttcttttcc

DBGET integrated database retrieval system