Methanococcus maripaludis C6: MmarC6_0799 Help Entry MmarC6_0799       CDS       T00615                                  Name (GenBank) LSU ribosomal protein L40E   KO K02927   ubiquitin-large subunit ribosomal protein L40e Organism mmx  Methanococcus maripaludis C6 Pathway mmx03010   Ribosome Brite KEGG Orthology (KO) [BR:mmx00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     MmarC6_0799   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     MmarC6_0799  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:mmx03011]     MmarC6_0799    04121 Ubiquitin system [BR:mmx04121]     MmarC6_0799 Ribosome [BR:mmx03011]  Ribosomal proteins   Eukaryotes    Large subunit     MmarC6_0799   Archaea     MmarC6_0799 Ubiquitin system [BR:mmx04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    MmarC6_0799 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ribosomal_L40e DZR DZR_2 SelP_N Zn_Ribbon_1 Zn_ribbon_RPAB4 HypA Zn_ribbon_13 zf-ChsH2 Motif Other DBs NCBI-ProteinID:  ABX01616 UniProt:  A9A8E3 LinkDB All DBs Position complement(742019..742162) Genome browser AA seq 47 aa AA seqDB search MAFEEAIKRVFMKKICMKCNSRNSWKATKCRKCGYTNLRPKAKEARA NT seq 144 nt NT seq  +upstreamnt  +downstreamnt atggcattcgaagaagcaatcaaaagagttttcatgaaaaagatttgcatgaaatgtaat tcaagaaactcatggaaagctacaaaatgtagaaaatgtggatacacaaatttaaggcct aaagctaaagaagctagagcataa

DBGET integrated database retrieval system