KEGG   Myotis myotis (greater mouse-eared bat): 118656724
Entry
118656724         CDS       T07220                                 
Symbol
ITGAX
Name
(RefSeq) integrin alpha-X isoform X1
  KO
K06462  integrin alpha X
Organism
mmyo  Myotis myotis (greater mouse-eared bat)
Pathway
mmyo04610  Complement and coagulation cascades
mmyo04810  Regulation of actin cytoskeleton
mmyo05152  Tuberculosis
Brite
KEGG Orthology (KO) [BR:mmyo00001]
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    118656724 (ITGAX)
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    118656724 (ITGAX)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    118656724 (ITGAX)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:mmyo04515]
    118656724 (ITGAX)
   04090 CD molecules [BR:mmyo04090]
    118656724 (ITGAX)
Cell adhesion molecules [BR:mmyo04515]
 Integrins
  Integrin alpha subunits
   118656724 (ITGAX)
CD molecules [BR:mmyo04090]
 Proteins
  118656724 (ITGAX)
SSDB
Motif
Pfam: VWA Integrin_alpha2 FG-GAP VWA_2 Integrin_alpha VWA_CoxE FG-GAP_3 FG-GAP_2
Other DBs
NCBI-GeneID: 118656724
NCBI-ProteinID: XP_036166191
LinkDB
Position
Unknown
AA seq 1156 aa
MSRTRTALLLLMGVASSLCFNLDIDKPTIFPMHSAGFGHSVVQYANWVVVGAPLEIKAVN
QTGGLYRCDYSTATCEPIQLQTPPEAVNMSLGLSLTAATTPPRLLACGPTVHHACNENMH
LAGVCFLWASSSWPTQRLPDALKECPRQEQDIVFLIDGSGSISSRDFAKMLKFVKAVMSQ
FQRPRAQFSLMQFSSTFRVHFTFKEFSQSSNPLRLLDSVRQLNQYTHTATAILRVTEELF
SAHKGARQDASKILIVITDGDKTGDNLEYEDVIPRAEAKGIVRYAVGVGSAFQDRRAFAE
LTAIASRPPQEHIFRVDNFDALRDIQRQLKEKIFAIEGTHTMSSSSFELEMSQEGFSAVL
TPDGPVLGAVGSYSWSGGAFLYPPNKKPPTFINMSQENVDMVDSYLGYSTELALWKGVQS
LVLGAPRHQHTGKAVIFTQAAGQWRPKAEVTGTQIGSYFGASLCSVDVDRDGSSDLVLIG
APHYYEPTRGGQVSVCPFPRGARWQCWAILRGEQGHPWGRFGAALTTMGDVNGDKLTDVA
IGAPGEEDNQGAVYLFHGASGPGISPSHSQRITGSQLSPGLQHFGQSLSGGQDLTLDSLV
DLAVGAQGHALLLRTRPVLRVWVEIHTTPTEIARSVFECRENTASIRDLGDATVCLRVHE
SPRTRLGNLQSDVTFDLTLDPGHLSPRAIFKETNTRHLSRVRVLGLRQHCEDVKLLLPAC
VEDAMIPITLSLNFSLVGQPIPSFGNLQPILAPDTRRHFTASLPFEKNCGDDHVCQDDLG
ITIDASGLETLVVGNTLELNMGVKVWNEGEDSYGTTVTFSYPPGLSYRRATVSQSRPPSR
SLQLACDSGSQDAWSTRCSLKHIIFREGAQVTFVATFDVSPKAMLGDRLLLTANVSSENN
SPRTLRTTSRLELPVKYSVYIVVSSHEESTKYLNFSASEEEGSSVAQLRYQVSNLGQRDL
PVSIYFLVPVELNQAAVWTELELLHPQSPSMNCSSERIVPTEADPRAHIQRNPVLDCSAA
ACRRFRCDVPSFGTQEELDFTLKGNLSFGWVRQTLQKKVSVVSMAGITFDRSVYAQLPGQ
EAFLRAQMEVVLEKQEVHNPVPLIVGSSVGGLLLLALITAILYKVGFFKRQYKEMMAEAN
EQAAPENGPPGPQGGQ
NT seq 3471 nt   +upstreamnt  +downstreamnt
atgagcaggaccaggacagcccttctcctgttgatgggcgtggcttcctctctctgcttc
aacttggacatcgacaagccaaccatcttccccatgcacagcgccgggtttggacacagt
gtggtccagtacgccaactgggtggtggtgggagcccccctggagataaaggctgtcaac
caaaccggtggcctctaccggtgtgactacagcacggccacctgtgagcccatccagctg
cagacgcccccagaggctgtgaacatgtccctgggcctatccctgacagctgccaccaca
ccccctcggctgctggcctgcggccccactgtgcaccatgcatgcaacgagaacatgcac
ttggccggggtctgcttcctgtgggcctcctcttcctggccgacccagaggctcccagat
gccctgaaggagtgcccgaggcaggagcaggacatcgtgttcctgatcgacggctcaggc
agcatcagctccagggattttgccaagatgctgaaattcgtgaaggctgtgatgagccag
ttccagagacccagggcccagttctccctgatgcagttctccagcaccttccgggttcac
ttcacgttcaaggaattctcgcagagctcaaacccactacggctgctggactctgtgagg
cagctgaaccagtacacgcacacggccacagctatcctgagggtcacagaagagctgttc
agtgcccacaagggggccagacaggacgcctccaagatcctcatcgtcatcacggacggg
gataaaacaggcgacaacctggaatatgaggatgtcatccctcgggccgaggccaagggc
attgtccgctatgcggtcggggtggggtcggcttttcaggaccgacgcgccttcgcagag
ctgaccgccatcgcgtccaggcccccgcaggagcacatattcagagtggacaactttgat
gctctgagagacattcaaaggcagctgaaagagaagatctttgccattgagggtacccac
accatgagcagcagctcctttgagttggagatgtcccaggagggcttcagcgcggtgctc
acgcccgacggaccagttctgggcgctgtggggagctacagctggtctggaggtgccttc
ctgtaccccccaaataagaaacctcccaccttcatcaacatgtctcaggagaatgtggac
atggtggactcctacctgggttactccaccgagctggccctttggaagggggtgcagagc
ctggtcctgggggccccccgccatcagcacaccgggaaggccgtcatcttcacccaggcg
gccgggcagtggaggccgaaggctgaagtcacagggacccagattggctcctacttcggg
gcctccctctgctccgtggacgtggacagagatggcagctccgacctggtcctcatcggg
gctccccattactacgagccgacccgggggggccaggtgtccgtgtgcccctttccccgg
ggggccaggtggcagtgctgggccattctccgtggggagcagggccacccctggggccgc
tttggggcagccctgaccaccatgggggacgtgaatggggacaagctgacggacgtggcc
atcggggccccgggggaggaggacaaccagggtgctgtgtacctgttccacggagcctcg
gggccgggcatcagcccctcccacagccagaggatcacaggctcccagctctcccctggg
ctccagcactttggacagtcgctgagcggaggccaggacctcaccctggacagccttgtg
gacctggccgtgggggcccaggggcacgcactgctgctcaggaccagacctgtgctcagg
gtgtgggtggagatccacacaacacccacagagattgctaggtctgtgttcgagtgtcgg
gagaacacagcctccatccgggacctgggtgatgccacagtctgccttcgtgtccatgaa
agtcccaggacccggctgggtaacctccaaagtgatgtgacctttgacctgacccttgac
cctggccacctgagtccccgagccatcttcaaggagacaaacactcggcatctgagccgc
gtcagagtcctcggtctgagacagcactgcgaggacgtgaagctgctgctcccggcttgc
gtggaggacgcgatgatccccatcaccttgagtctcaatttctccctggtgggccagccc
atcccttcctttgggaacctccagcctattctggctccagacacccgcagacacttcacg
gcctctctcccctttgagaagaactgtggggacgaccatgtctgccaggacgaccttggc
atcaccattgacgcctctggcttggagaccctggtggtggggaacaccctggagctgaac
atgggagtgaaagtgtggaatgagggcgaggactcctatgggaccacagtcaccttctcc
tacccgccagggctgtcctaccggcgggcgacagtgagccagagccggccgccgtcacgc
tccctgcaactggcctgcgacagcgggagccaggacgcctggagcacccgctgcagcctc
aaacacatcatcttccgcgagggagctcaggtcaccttcgtggccacctttgacgtctcc
cccaaggccatgctgggagaccggctgcttctaacggccaatgtgagcagtgagaacaac
tcccccaggaccctcaggaccacctcccggctggagctgccggtgaagtactccgtctac
atcgtggtcagcagccacgaagaatccaccaagtacctcaacttctcggcctcagaggag
gaggggagcagcgtggcccagctcagataccaggtgagcaacctggggcagagggacctg
cctgtcagcatctacttcttggtgcctgtggagctgaaccaggcggcggtgtggacagag
ctggagctcctccacccccagagcccatctatgaactgctcttcagagagaatagtgccc
acagaggccgacccccgggcccacattcagaggaatcccgtgctggactgctccgctgct
gcctgccggaggttccgctgtgacgtgccctcctttggcacccaggaggaactggacttc
accctgaagggcaacctcagcttcggctgggtcagacagactctgcagaagaaggtatcg
gtcgtgagtatggcgggaatcacgttcgacagatctgtgtatgcccagctcccgggccag
gaggcgtttctgagagcccagatggaggtggtgctggagaagcaggaggtccacaacccc
gtgcccctcattgtgggcagctccgtgggaggactgctgctgctggctctcatcacagcc
atactgtacaaggttggcttctttaaacgtcagtacaaagagatgatggcggaagcaaat
gaacaagctgccccagaaaatgggccaccgggcccccaaggtggccaatga

DBGET integrated database retrieval system