Myotis myotis (greater mouse-eared bat): 118656866 Help Entry 118656866         CDS       T07220                                  Symbol ELOB Name (RefSeq) elongin-B   KO K03873   elongin-B Organism mmyo  Myotis myotis (greater mouse-eared bat) Pathway mmyo04066   HIF-1 signaling pathway mmyo04120   Ubiquitin mediated proteolysis mmyo05170   Human immunodeficiency virus 1 infection mmyo05200   Pathways in cancer mmyo05211   Renal cell carcinoma Brite KEGG Orthology (KO) [BR:mmyo00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     118656866 (ELOB)  09130 Environmental Information Processing   09132 Signal transduction    04066 HIF-1 signaling pathway     118656866 (ELOB)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     118656866 (ELOB)   09162 Cancer: specific types    05211 Renal cell carcinoma     118656866 (ELOB)   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     118656866 (ELOB)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:mmyo04121]     118656866 (ELOB)    03400 DNA repair and recombination proteins [BR:mmyo03400]     118656866 (ELOB) Ubiquitin system [BR:mmyo04121]  Ubiquitin ligases (E3)   Multi subunit type E3    Cul2 complex     Adoptor protein      118656866 (ELOB)    Cul5 complex      118656866 (ELOB) DNA repair and recombination proteins [BR:mmyo03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     Other NER factors      118656866 (ELOB) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  ubiquitin Rad60-SLD Motif Other DBs NCBI-GeneID:  118656866 NCBI-ProteinID:  XP_036166512 LinkDB All DBs Position Unknown AA seq 118 aa AA seqDB search MDVFLMIRRHKTTIFTDAKESSTVFELKRIVEGILKRPPDEQRLYKDDQLLDDSKTLGEC GFTSQTARPQAPATVGLAFRADDAFEALRIEPFSSPPELPDVMKPQDSGSSANEQAVQ NT seq 357 nt NT seq  +upstreamnt  +downstreamnt atggacgtgttccttatgatccggcgccacaagaccaccatcttcacggacgccaaggag tcgagcaccgtgttcgagctgaaacgcatcgttgagggcattctcaagaggccgcccgac gagcagcggctgtacaaggatgaccagcttctggatgacagcaagaccctgggcgagtgt ggcttcaccagtcaaacagcgaggccccaggccccagccactgtggggctggccttccgg gcagatgatgcatttgaagctctgcgcattgagcccttctccagccctccagagctgcct gacgtgatgaagccacaggactcaggaagcagtgccaatgaacaagctgtgcagtga

DBGET integrated database retrieval system