Myotis myotis (greater mouse-eared bat): 118657683 Help Entry 118657683         CDS       T07220                                  Symbol PFN3 Name (RefSeq) profilin-3   KO K05759   profilin Organism mmyo  Myotis myotis (greater mouse-eared bat) Pathway mmyo04015   Rap1 signaling pathway mmyo04810   Regulation of actin cytoskeleton mmyo05014   Amyotrophic lateral sclerosis mmyo05132   Salmonella infection Brite KEGG Orthology (KO) [BR:mmyo00001]  09130 Environmental Information Processing   09132 Signal transduction    04015 Rap1 signaling pathway     118657683 (PFN3)  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     118657683 (PFN3)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     118657683 (PFN3)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     118657683 (PFN3)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:mmyo04131]     118657683 (PFN3)   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:mmyo04812]     118657683 (PFN3)    04147 Exosome [BR:mmyo04147]     118657683 (PFN3) Membrane trafficking [BR:mmyo04131]  Others   Actin-binding proteins    Others     118657683 (PFN3) Cytoskeleton proteins [BR:mmyo04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Profilin      118657683 (PFN3) Exosome [BR:mmyo04147]  Exosomal proteins   Proteins found in most exosomes    118657683 (PFN3) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Profilin Motif Other DBs NCBI-GeneID:  118657683 NCBI-ProteinID:  XP_036167912 LinkDB All DBs Position Unknown AA seq 137 aa AA seqDB search MGEWKAYISAVLQDQRIDDVAIVGHSDNRCVWASRPGGLLAAISPQEVGVLTGQDRCTFL QAGLSVAGRRCCVIRDHLLAEGDGVLDARTKGLDGRAVCVGHTPRALLVLMGRRGVHGGI LNKKVHELIHWLRTQGT NT seq 414 nt NT seq  +upstreamnt  +downstreamnt atgggcgagtggaaagcctacatcagtgcggtgctgcaggaccagcgcatcgacgacgta gccatcgtgggccactcggacaatcgctgtgtgtgggcatcgcggcccgggggactgctg gccgccatctcgccgcaggaggtgggtgtgctcacggggcaggaccggtgcaccttcctg caggccggcctgagcgtggcgggccgccgctgctgcgtcatcagagaccacctgctggcg gagggcgacggcgtgctggacgcgcgcaccaaggggctggatgggcgcgcggtctgcgtg ggccacacgccgcgcgctcttctcgtgctcatgggccggcggggcgtgcacgggggcatc ctcaacaagaaggtgcacgagttgatccactggctgcgcactcagggcacctag

DBGET integrated database retrieval system