Myotis myotis (greater mouse-eared bat): 118658442 Help Entry 118658442         CDS       T07220                                  Symbol IL5 Name (RefSeq) interleukin-5   KO K05428   interleukin 5 Organism mmyo  Myotis myotis (greater mouse-eared bat) Pathway mmyo04060   Cytokine-cytokine receptor interaction mmyo04630   JAK-STAT signaling pathway mmyo04640   Hematopoietic cell lineage mmyo04657   IL-17 signaling pathway mmyo04658   Th1 and Th2 cell differentiation mmyo04660   T cell receptor signaling pathway mmyo04664   Fc epsilon RI signaling pathway mmyo04672   Intestinal immune network for IgA production mmyo05200   Pathways in cancer mmyo05310   Asthma mmyo05320   Autoimmune thyroid disease mmyo05321   Inflammatory bowel disease mmyo05330   Allograft rejection Brite KEGG Orthology (KO) [BR:mmyo00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     118658442 (IL5)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     118658442 (IL5)  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     118658442 (IL5)    04660 T cell receptor signaling pathway     118658442 (IL5)    04658 Th1 and Th2 cell differentiation     118658442 (IL5)    04657 IL-17 signaling pathway     118658442 (IL5)    04664 Fc epsilon RI signaling pathway     118658442 (IL5)    04672 Intestinal immune network for IgA production     118658442 (IL5)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     118658442 (IL5)   09163 Immune disease    05310 Asthma     118658442 (IL5)    05320 Autoimmune thyroid disease     118658442 (IL5)    05321 Inflammatory bowel disease     118658442 (IL5)    05330 Allograft rejection     118658442 (IL5)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:mmyo04052]     118658442 (IL5)    00536 Glycosaminoglycan binding proteins [BR:mmyo00536]     118658442 (IL5) Cytokines and neuropeptides [BR:mmyo04052]  Cytokines   Interleukins    118658442 (IL5) Glycosaminoglycan binding proteins [BR:mmyo00536]  Heparan sulfate / Heparin   Cytokines    118658442 (IL5) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL5 Motif Other DBs NCBI-GeneID:  118658442 NCBI-ProteinID:  XP_036169882 UniProt:  A0A7J7XGS4 LinkDB All DBs Position Unknown AA seq 132 aa AA seqDB search MLLLLTFLALGAADVGAIALESPLKRLVAETLTLLSTHRTLLIGEGNLMIPTPGHTNYQL CIKEVFQGVDTLRNQTAEVDAVEKLFQNLSSIKDYIDGEKKKCEGERLRVKKFLDYLQVF LGVINTEWTMES NT seq 399 nt NT seq  +upstreamnt  +downstreamnt atgcttctgcttttgactttcctggctctcggagctgccgacgttggtgccattgcctta gaaagtcccttgaagagactggtggcagagaccttgaccctgctctccactcatcggact ctgctgataggcgaagggaacctgatgattcctactccaggacatacaaattaccaacta tgcattaaagaagtctttcagggggtagacacattgaggaatcaaactgcagaagtggat gccgtggaaaaactcttccagaacttgtcttcaataaaagactacatagatggcgaaaaa aaaaagtgtgaaggggaacgattgagagtaaaaaagttcctcgactacctgcaagtattt cttggcgtgataaacactgagtggacaatggaaagctga

DBGET integrated database retrieval system