Myotis myotis (greater mouse-eared bat): 118659089 Help Entry 118659089         CDS       T07220                                  Symbol UBL5 Name (RefSeq) ubiquitin-like protein 5   KO K13113   ubiquitin-like protein 5 Organism mmyo  Myotis myotis (greater mouse-eared bat) Brite KEGG Orthology (KO) [BR:mmyo00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03041 Spliceosome [BR:mmyo03041]     118659089 (UBL5)   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:mmyo04052]     118659089 (UBL5) Spliceosome [BR:mmyo03041]  Complex B   Other components    Complex B specific factors     118659089 (UBL5) Cytokines and neuropeptides [BR:mmyo04052]  Neuropeptides   Unclassified    118659089 (UBL5) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  ubiquitin Ubiquitin_2 Crinkler Motif Other DBs NCBI-GeneID:  118659089 NCBI-ProteinID:  XP_036171020 LinkDB All DBs Position Unknown AA seq 73 aa AA seqDB search MIEVVCNDRLGKKVRVKCNTDDTIGDLKKLIAAQTGTRWNKIVLKKWYTIFKDHVSLGDY EIHDGMNLELYYQ NT seq 222 nt NT seq  +upstreamnt  +downstreamnt atgatcgaggtggtttgcaacgaccgtctggggaagaaggtccgcgtgaagtgcaacacc gatgacaccatcggggacctgaagaagctgatcgccgcccagacggggacccgttggaac aagatcgtgctgaagaagtggtacacgatctttaaggaccacgtttctctgggcgactat gaaatccatgatgggatgaacctggagctttattaccaataa

DBGET integrated database retrieval system